KEGG   Cupriavidus sp. USMAA1020: BKK80_19225Help
Entry
BKK80_19225       CDS       T04978                                 

Definition
(GenBank) amidase
  KO
K01426  amidase [EC:3.5.1.4]
Organism
cup  Cupriavidus sp. USMAA1020
Pathway
cup00330  Arginine and proline metabolism
cup00360  Phenylalanine metabolism
cup00380  Tryptophan metabolism
cup00627  Aminobenzoate degradation
cup00643  Styrene degradation
cup01100  Metabolic pathways
cup01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cup00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    BKK80_19225
   00360 Phenylalanine metabolism
    BKK80_19225
   00380 Tryptophan metabolism
    BKK80_19225
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BKK80_19225
   00643 Styrene degradation
    BKK80_19225
Enzymes [BR:cup01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.4  amidase
     BKK80_19225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AOZ07722
Position
1:4245067..4246578
Genome map
AA seq 503 aa AA seqDB search
MTATAPAATAAHARPTPNAAPEGGTGSTIVALDAVALSHAIHAREVSCAEVLDAYLAQID
RLNPLVNAIVAPAAREALAAQAAERDAELARGHSRGPLHGFPQAPKDIMPVAGMVTTKGS
PVFRDHVPTADAVVFERMRAGGALFVGRTNSPEFGLGGHTYNPIYGATRNAFDPGRSAGG
SSGGAGVAVALRMLPVADGSDMMGSLRTPAAFNNVYGLRTSFGCVPHGPTEEVFFQQFSV
AGPMARNIPDLALLLSVQAGFDARLPLTRRAETPGSFAPALERDLRGTRIGWLGDLGGHL
PTEPGLLDTCAAALAHFRTIGCHVEPVQPAFDLDSLWRAWIDLRSFSVAGANAALYHDPA
KRALLKPEAVWEIERGLALGAMQVYDAARVRSAWYQALRTLFERVDFLVMPATQVFPFPV
DWDWPKAIDGRAMDTYHRWMQAVVPATMAGLPVLSAPAGFGPGGLPCGLQIIGPAQADAA
VLQLGHAYDQASGYARVASPLLG
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccaccgcccccgccgccaccgcagcacacgcccgcccgaccccgaatgccgct
ccggaaggtggcaccggaagcaccatcgtcgccctcgacgccgtcgccctgtcgcacgcc
atccacgcgcgcgaggtgtcgtgcgccgaggtgctcgacgcctacctggcgcagatcgac
cgcctgaacccgctggtcaacgccatcgtcgcgccggccgcgcgcgaggcgctggcggcc
caggccgccgaacgcgacgccgagctggcgcgcggccacagccgcggcccgctgcacggt
ttcccgcaggcgcccaaggacatcatgccggtggccggcatggtcaccaccaagggctcg
ccggtgttccgcgaccatgtgcccaccgccgatgccgtggtgttcgagcgcatgcgcgcc
ggcggcgcgctcttcgtcggccgcaccaactcgcccgagttcggcctcggcggccatacc
tacaaccccatctacggcgccacccgcaatgccttcgaccccggccgctcggccggcggc
agcagcggcggcgccggcgtggcggtggcgctgcgcatgctgccggtggccgacggctcc
gacatgatgggctcgctgcgcacgccggccgccttcaacaacgtctacggcctgcgcacc
tcgttcggctgcgtgccgcacggccccaccgaagaagtgttcttccagcagttcagcgtg
gccggcccgatggcgcgcaacatccccgacctggcgctgctgctgtcggtgcaggccggc
ttcgacgcacgcctgccgctgacgcgccgcgccgagacccccggcagcttcgcgcccgcg
ctggagcgcgacctgcgcggcacccgcatcggctggctgggcgacctcggcggccacctg
ccgacggaacccggcctgctcgacacctgcgcggcggcgctggcccacttccgtaccatc
ggctgccacgtcgagccggtgcagccggccttcgacctggacagcctgtggcgcgcctgg
atcgacctgcgcagcttctcggtggcgggcgccaacgcggcgctgtaccacgacccggcc
aagcgcgccctgctcaagccggaagcggtctgggagatcgagcgcggcctcgccctgggc
gccatgcaggtctacgacgcggcgcgcgtgcgcagcgcctggtaccaggcgctgcgcacg
ctgttcgagcgcgtcgacttcctggtcatgccggccacccaggtcttccccttcccggtg
gactgggactggcccaaggccatcgacgggcgcgccatggatacctaccaccgctggatg
caggccgtggtgccggccaccatggcaggactgccggtgctgtccgcaccggcgggcttc
ggccccggcggcctgccctgcgggctgcagatcatcggcccggcgcaggccgacgccgcg
gtgctgcagctcggccacgcctacgaccaggccagcggctacgcgcgcgtcgccagcccg
ctgctgggctga

DBGET integrated database retrieval system