KEGG   Cupriavidus sp. USMAA1020: BKK80_28265Help
Entry
BKK80_28265       CDS       T04978                                 

Definition
(GenBank) butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
cup  Cupriavidus sp. USMAA1020
Pathway
cup00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:cup00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BKK80_28265
Enzymes [BR:cup01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     BKK80_28265
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     BKK80_28265
    1.1.1.-  
     BKK80_28265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 ADH_N_assoc AlaDh_PNT_C 2-Hacid_dh_C DAO
Motif
Other DBs
NCBI-ProteinID: AOZ10888
Position
2:1973555..1974637
Genome map
AA seq 360 aa AA seqDB search
MKAAVWRGRHDVRVEEVRVPDKPAEGWVKIRVHWCGICGSDLHEYVAGPVFIPVDHPHPL
TGLKGQCILGHEFSGEIAELGAGVTGFQVGERVTADACQHCGKCYYCTHGLYNICENLAF
TGLMNNGAFAEYVNVPAELLYKLPENFPTEAGALIEPLAVGLHAVKKAGNIVGQTVVVVG
AGTIGLCTIMCAKAAGAGRIIALEMSSARKKKALEVGANVVIDPKECDAIAEVKALTGGY
GADVSFECIGNKATAKLAIDVIRKAGKCVMVGIFEEPSAFNFFEIVSTEKEIIGSLAYNG
EFADVIRFIADGRIDVQPLITGRISLADIVSHGFEELVNNKDGNVKIIVQPIASRSALTA
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgaaggccgccgtatggcggggccgccacgatgtgcgcgtcgaggaagtgcgcgttccg
gacaagcccgccgagggatgggtaaagatccgcgtgcattggtgcggcatctgcgggtcg
gacttgcatgagtatgtcgcggggccggtctttatcccggtcgatcatccccacccgctc
accggcctgaaggggcaatgcatactcggtcacgagttcagcggcgaaatcgctgagctg
ggtgcaggcgtcaccggtttccaggtcggcgaacgcgtcaccgcggacgcctgccagcat
tgcgggaaatgctattactgcacccatggcctgtacaacatctgcgagaacctcgcgttc
accggcctgatgaacaatggcgcattcgcggaatacgtcaacgtgccggcggagctgctc
tacaagctgccggagaacttcccgaccgaggcaggcgcgttgatcgagccgctggcggta
gggcttcatgccgtgaagaaagccggcaacatcgtcggccagacggtggtggtggtcggc
gccggcaccatcggcctgtgcacgatcatgtgcgcgaaggcggccggcgcaggacgcatc
atcgcgctcgaaatgtcgtcggcgcgcaagaagaaggcgctcgaagtcggtgccaacgtc
gtcatcgatcccaaggagtgcgatgcgatcgcggaggtcaaggcgctgaccggcggctat
ggcgcggacgtgtccttcgagtgcatcggcaacaaggccacggcgaagcttgccatcgac
gtgatccgcaaagccggcaaatgcgtgatggtggggattttcgaagaacccagcgcgttc
aatttcttcgagatcgtatcgacggagaaggaaatcatcggatcgctcgcctataacggc
gaattcgccgacgtgatccgctttatcgccgatggccgcatcgacgtgcagccgctcatc
acagggcggatctccctcgccgacattgtgtcgcacggcttcgaagagctcgtcaacaac
aaggacggcaacgtcaagatcatcgtccagccgattgccagccggtcggctttgacagcc
tga

DBGET integrated database retrieval system