KEGG   Cupriavidus malaysiensis: BKK80_28675Help
Entry
BKK80_28675       CDS       T04978                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K17760  quinohemoprotein ethanol dehydrogenase [EC:1.1.9.1]
Organism
cup  Cupriavidus malaysiensis
Brite
KEGG Orthology (KO) [BR:cup00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BKK80_28675
Enzymes [BR:cup01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.9  With a copper protein as acceptor
    1.1.9.1  alcohol dehydrogenase (azurin)
     BKK80_28675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PQQ_2 PQQ PQQ_3 Cytochrome_CBB3 Cytochrom_C
Motif
Other DBs
NCBI-ProteinID: AOZ09690
Position
2:complement(2061962..2064133)
Genome map
AA seq 723 aa AA seqDB search
MKDSTGKADGARMARRGMTAALAAALTAGALLPALAGAAGGAQDSAGPGVARLRAITARV
DGASIQANAARTADWPSYGLDYGETRFSKLDQINTGNAKELGLAWSYDLESTRGVEATPI
VVDGVMYVSAPWSVVHAVDARSGRRLWTYDPQVPRRLGYKGCCDVVNRGVALYQGKVYVG
TFDGRLVAIDAATGKRVWERDTIADHRHSYTITGAPRVVKGKVIIGNGGAEYGARGYVTA
YDAATGAQKWRWFTVPGDPARPYENEAMAKAAKTWDPSGKYWVNGGGGTVWNSMAFDPGL
NLLYIGTGNGGPWSRKQRSPKGGDNLYLASIVALDPDTGKYVWHYQETPGDNADYTSTQD
IILADLKIDGQPRKVILHAPKNGFFFVIDRTNGKFISARNFVDVNWASGYDQDGRPIETP
LFDTSGKPVDAVPGPFGAHNWHAMSFNPQLGLAYIPAQHVPLTLADDKRWEHNQKDSAEA
HSGVGWNLGMLVNEAPPASKPFGRLIAWDPVRQKAAWQQDYASPWNGGTLTTAGKLVFQG
TADGRFIAYDAATGEKLWQAPTGTGVVAPPVTYLVDGKQYVSVAVGWGGVFGLSARATDR
QAPGTVYTFALGGKAKAPEWSAYPMAELLSGVKYDPAHVEAGKKLYVNNCVFCHGVPGVD
KGGNIPNLAYVGAGPIEHLDKMLFNGPFVSRGMPDFTGKLSADDVVKIQAFIQGTADAVR
PKP
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atgaaggattcgacaggcaaggccgatggcgcacggatggcgcgccgcgggatgacggcg
gcactggcggcggcactgacggcaggcgctttgctgccggcgctggcgggcgcggcgggc
ggcgcgcaggacagcgccggcccgggcgtggcgcgcctgcgcgccatcacggcacgcgtg
gacggcgcgagcatccaggccaacgcggcgcgcacggcggactggccgtcctatgggctg
gattacggcgagacccgcttcagcaagctggaccagatcaacacgggcaatgccaaggag
ctgggcctggcctggagctacgacctggagtcgacgcgcggggtcgaggccacgccgatc
gtggtcgacggcgtcatgtacgtgtcggcgccctggagcgtcgtgcatgcggtggacgcg
cgcagcggccggcgcttgtggacctatgatccgcaggtgccgcgccggctcggctacaag
ggctgctgcgacgtggtcaaccgcggcgtggcgctgtaccagggcaaggtctacgttggc
accttcgacggccgcctggtcgccatcgatgccgccaccggcaagagagtgtgggagcgc
gacaccatcgccgaccaccgccattcctacaccatcaccggcgcgccgcgcgtggtcaag
ggcaaggtcatcatcggcaacggtggcgcggagtacggcgcgcgcggctatgtcaccgcc
tacgacgccgccaccggcgcgcagaagtggcgctggttcacggtgcccggcgacccggcc
aggccctacgagaacgaggcgatggcgaaggccgccaagacctgggacccgagcggcaag
tactgggtcaacggcggcggcggcacggtctggaacagcatggccttcgatcccggcctg
aacctgctctatatcggcaccggcaacggcgggccgtggagccgcaagcagcgcagcccc
aagggtggcgacaacctctacctggcgtcgatcgtcgcgctcgatcccgacaccggcaag
tacgtgtggcactaccaggagacgccgggggacaacgccgactacacctcgacccaggac
atcatcctggccgacctgaagatcgacgggcagccgcgcaaggtcatcctgcacgcgccc
aagaacggtttcttcttcgtcatcgaccgcaccaacggcaagttcatctcggccaggaac
ttcgtcgacgtcaactgggccagcggctacgaccaggacgggcggcccatcgagacgccg
ctgttcgacacctcgggcaagccggtggacgcggtgcccgggccgttcggcgcgcacaac
tggcacgccatgtcgttcaacccgcagctgggcctggcctatattccggcccagcacgtg
ccgctcacgctggccgacgacaagcgctgggagcacaaccagaaggactcggccgaggcg
cacagcggcgtgggctggaatctcggcatgctggtcaacgaggcgccgccggccagcaag
ccattcggccgcctgatcgcctgggacccggtgcggcagaaggccgcctggcagcaggac
tatgccagcccgtggaacggcggcacgctgaccacggccggcaagctggtgttccagggc
accgccgacggccgcttcatcgcctacgacgcggccacgggggagaagctgtggcaggcg
cccaccggcaccggcgtggtggcgccgcccgtcacctatctcgtcgacggcaagcagtac
gtgtcggtggcggtgggctggggcggcgtgttcgggctgagcgcgcgtgccaccgaccgc
caggcgccgggcacggtgtacaccttcgccctcggcggcaaggccaaggcaccggagtgg
agcgcgtatccgatggcggagctgctgagcggcgtcaagtacgaccccgctcacgtcgag
gccggcaagaagctctacgtcaacaactgcgtgttctgccacggggtgccgggcgtcgac
aagggcggcaacatccccaacctggcctatgtcggcgcgggcccgatcgagcatctcgac
aagatgctgttcaacggccccttcgtctcgcgcggcatgccggacttcaccggcaagctg
agcgccgacgatgtcgtgaagatccaggccttcatccagggcaccgccgacgcggtgcgg
ccgaagccctga

DBGET integrated database retrieval system