KEGG   Cupriavidus sp. USMAA1020: BKK80_34010Help
Entry
BKK80_34010       CDS       T04978                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cup  Cupriavidus sp. USMAA1020
Pathway
cup00071  Fatty acid degradation
cup00072  Synthesis and degradation of ketone bodies
cup00280  Valine, leucine and isoleucine degradation
cup00310  Lysine degradation
cup00362  Benzoate degradation
cup00380  Tryptophan metabolism
cup00620  Pyruvate metabolism
cup00630  Glyoxylate and dicarboxylate metabolism
cup00640  Propanoate metabolism
cup00650  Butanoate metabolism
cup00900  Terpenoid backbone biosynthesis
cup01100  Metabolic pathways
cup01110  Biosynthesis of secondary metabolites
cup01120  Microbial metabolism in diverse environments
cup01130  Biosynthesis of antibiotics
cup01200  Carbon metabolism
cup01212  Fatty acid metabolism
cup02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cup00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BKK80_34010
   00630 Glyoxylate and dicarboxylate metabolism
    BKK80_34010
   00640 Propanoate metabolism
    BKK80_34010
   00650 Butanoate metabolism
    BKK80_34010
  Lipid metabolism
   00071 Fatty acid degradation
    BKK80_34010
   00072 Synthesis and degradation of ketone bodies
    BKK80_34010
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BKK80_34010
   00310 Lysine degradation
    BKK80_34010
   00380 Tryptophan metabolism
    BKK80_34010
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BKK80_34010
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BKK80_34010
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BKK80_34010
Enzymes [BR:cup01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BKK80_34010
Exosome [BR:cup04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BKK80_34010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III PTA_PTB SnoaL_4
Motif
Other DBs
NCBI-ProteinID: AOZ10566
Position
2:3281974..3283182
Genome map
AA seq 402 aa AA seqDB search
MRRAAIVTPLRTPVGTFGGSLRPVPVEELAATTVRAVVQKSGIDPARIDDVVFAQSYANS
EVPCVGRWAALQAGLPVEVPGMQLDRRCGGGLQAIVTAAMMVQSGAADVVIAGGVESMSN
IEYYTTDMRWGARSGNVRFFDRLDRGRERSQPVERFGRISGMIETAENLARDYGISREQA
DAFAVRSHARAAAAWEAGRFADEIVPVQVPQRKGDPVAFTRDEGFRPDTSLASLAKLRAL
MPDGTVTAGNASQQNDASAACLIVAEDKLAELGLTPMATLVGWAAAGCEPSHMGIGPVPA
VKKLLARLNLTLEQMDLVELNEAFACQVLAVLKGWDWHDQDAIEHKLNVNGSGISLGHPI
GATGVRILATLLHELQRRGGRYGLETMCIGGGQGIAAVFERC
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgcgcagagccgcaatcgtcacccccctccgcacccccgtcggcaccttcggcggcagc
ctgcgaccggtgcccgtcgaggaactggccgccaccacggtgcgcgccgtggtgcagaag
agcggcatcgatcccgcccgcatcgacgacgtggtgttcgcccagtcctacgccaacagc
gaagtgccctgcgtgggccgctgggccgcgctgcaggccggcctgccggtcgaggtgccg
ggcatgcagctcgaccgccgctgcggcggcggcctgcaggccatcgtcaccgccgcgatg
atggtgcagagcggcgccgccgacgtggtgatcgcgggtggcgtggagagcatgagcaat
atcgagtactacaccaccgacatgcgctggggcgcgcgctcgggcaatgtgcgcttcttc
gaccgcctcgaccgcggccgcgaacgctcgcagccggtggagcgcttcggcaggatctcc
ggcatgatcgagaccgccgagaacctggcgcgcgactacggcatcagccgcgagcaggcc
gacgccttcgccgtgcgcagccacgcgcgcgccgcggcggcgtgggaagcgggccgcttc
gccgatgagatcgtgccggtccaggtgccgcagcgcaagggcgaccccgtcgccttcacg
cgcgacgagggcttccgccccgatacctcgctggccagcctggccaagctgcgcgcgctg
atgcccgacggcaccgtcaccgccggcaacgccagccagcagaacgatgcctccgccgcc
tgcctgatcgtggccgaggacaagctggccgagctcggcctcacccccatggccacgctg
gtgggctgggcggccgccggctgcgagccctcgcacatgggcatcggcccggtgccggcg
gtgaagaagctgctggcgcgcctgaacctgacgctggagcagatggacctggtcgagctg
aacgaggccttcgcctgccaggtgctggccgtgctcaagggctgggactggcacgaccag
gatgccatcgagcacaagctcaacgtcaacggctccggcatctcgctgggccacccgatc
ggcgccaccggcgtgcgcatcctggccacgctgctgcacgagctgcagcgccgcggcggc
cgctacgggctggaaaccatgtgcatcggcggcggccagggtatcgccgccgtcttcgag
cgctgctga

DBGET integrated database retrieval system