KEGG   Corynebacterium ulcerans 210931: Cul210931_1360Help
Entry
Cul210931_1360    CDS       T03414                                 

Gene name
mqo
Definition
(GenBank) Malate:quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
cuq  Corynebacterium ulcerans 210931
Pathway
cuq00020  Citrate cycle (TCA cycle)
cuq00620  Pyruvate metabolism
cuq01100  Metabolic pathways
cuq01110  Biosynthesis of secondary metabolites
cuq01120  Microbial metabolism in diverse environments
cuq01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cuq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Cul210931_1360 (mqo)
   00620 Pyruvate metabolism
    Cul210931_1360 (mqo)
Enzymes [BR:cuq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     Cul210931_1360 (mqo)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO Pyr_redox_2 FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AIU30696
UniProt: A0A5A4RLK9
Position
complement(1493650..1495149)
Genome map
AA seq 499 aa AA seqDB search
MADSINAQRVTDEVDVALIGGGIMSATLGAMLRTLEPSWSQVLFERLDAPAQESSSPWNN
AGTGHSALCELNYTPEVNGRIEINKALGVNEKFQVSRQFWSYQINQGVLPNPREWINPVP
HVSFARGEAQVNYLKKRYDALANHPLFPNMQYTDDRSVFNDMLPLMADGRSEFEKVAISW
TDAGTDINYGSQTRQFLKAAEANGTNIRYGHEVKDITRDGGKWKIKVKNVHTGDIQVIRA
NFVFVGAGGMALPLLQKSGIPEIRGWGGFPVSGQWLRCTNQEVIEQHSAKVYGKASIGAP
PMSVPHLDTRVIDGEKGLLFGPYAGWTPKFLKKGSYFDLVKSIRPTNLMSYLGVGAQEFG
LTKYLITEVLKDQSARMESLREYMPNARDEDWELITAGQRVQAIEPVVGPRFSSLAFGTS
LINSADGSIAGILGASPGASIAPAAMLELLERCFGQRMVEWGDKIKEMIPSYGIKLATDK
RLFEEIWDYTQTTLQLDQD
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atggcagattccatcaacgcgcaacgggtcacggacgaagtagacgttgccctgatcggc
ggcggcatcatgagtgccacccttggcgctatgctccgcacacttgaacctagctggtct
caggtcctctttgagcgtctcgatgcacctgctcaagagtcatcctcgccgtggaacaac
gcagggacagggcattcggctctgtgcgagctgaattacacgccggaagttaacgggcgt
attgaaatcaataaagctctgggcgtaaatgagaagttccaagtttctcgccagttctgg
tcttatcaaattaaccaaggggttctgccgaatcctcgcgagtggattaaccctgtacct
cacgtttcctttgctcgtggtgaagcgcaggttaactatttgaaaaagcgttacgacgct
ctagctaaccacccgctgttccccaatatgcagtacacggatgaccgtagtgtgttcaat
gacatgctgccgttgatggctgatggacgtagcgaatttgagaaggttgcgatttcctgg
actgatgctggcacggacattaactatggatcacagactcgccagttcctcaaagcggcc
gaggctaatggcaccaatatccgttatggccacgaggttaaagatattactcgtgatggc
ggtaagtggaagattaaagttaaaaacgttcacaccggtgatattcaagttattcgtgca
aactttgtctttgttggcgctggtggaatggcactcccgctgctccaaaaatctggcatt
ccggaaatacgtgggtggggcggtttccccgtatccggtcagtggctgcgctgtaccaac
caagaagtcatagaacagcattcggcgaaagtttatggcaaagcatctatcggcgcgccc
ccgatgtcggtgcctcacttggatactcgcgtcatcgatggagaaaaaggtctgctgttt
ggcccttatgcgggatggacgccaaaattcttaaagaagggctcgtacttcgacctcgtt
aagtcgatccgtcccacaaacctgatgtcttatctaggcgttggagcgcaggaatttggc
ctgactaagtacctcatcactgaggtgcttaaggatcaatcagctcggatggagtctctg
cgcgagtacatgcctaatgcgcgcgatgaagactgggaactgattacagccggtcagcgt
gtgcaggctatcgagcccgttgtgggtccgcgattctcctctttggcttttggtacttcc
cttattaactccgctgacggatctatcgccggcatccttggtgcgtcgccaggtgcctct
attgcaccagccgcgatgttggaactgcttgagcgttgctttggtcagcgtatggttgaa
tggggcgacaagattaaggaaatgattccttcctacgggattaagcttgctacggataag
cgactatttgaagagatttgggattatacccagaccactctgcagcttgatcaagactaa

DBGET integrated database retrieval system