KEGG   Corynebacterium urealyticum DSM 7109: cu0179Help
Entry
cu0179            CDS       T00685                                 

Gene name
fadA1
Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cur  Corynebacterium urealyticum DSM 7109
Pathway
cur00071  Fatty acid degradation
cur00280  Valine, leucine and isoleucine degradation
cur00310  Lysine degradation
cur00362  Benzoate degradation
cur00380  Tryptophan metabolism
cur00620  Pyruvate metabolism
cur00630  Glyoxylate and dicarboxylate metabolism
cur00640  Propanoate metabolism
cur00650  Butanoate metabolism
cur00900  Terpenoid backbone biosynthesis
cur01100  Metabolic pathways
cur01110  Biosynthesis of secondary metabolites
cur01120  Microbial metabolism in diverse environments
cur01130  Biosynthesis of antibiotics
cur01200  Carbon metabolism
cur01212  Fatty acid metabolism
cur02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cur00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    cu0179 (fadA1)
   00630 Glyoxylate and dicarboxylate metabolism
    cu0179 (fadA1)
   00640 Propanoate metabolism
    cu0179 (fadA1)
   00650 Butanoate metabolism
    cu0179 (fadA1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    cu0179 (fadA1)
   00072 Synthesis and degradation of ketone bodies
    cu0179 (fadA1)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    cu0179 (fadA1)
   00310 Lysine degradation
    cu0179 (fadA1)
   00380 Tryptophan metabolism
    cu0179 (fadA1)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    cu0179 (fadA1)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    cu0179 (fadA1)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    cu0179 (fadA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cur04147]
    cu0179 (fadA1)
Enzymes [BR:cur01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     cu0179 (fadA1)
Exosome [BR:cur04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   cu0179 (fadA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C Ketoacyl-synt_C ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: CAQ04139
UniProt: B1VEF0
Position
complement(223170..224399)
Genome map
AA seq 409 aa AA seqDB search
MTSNSGAPEAFIYDAVRTPRGKGKPGGSLHTVKPVSLLSGLIEAILERNPGLDPARINDV
IAGCVTPVGDQGMDIARTAALNAGLPYSATGLQVNRYCASGLTALNLAAQKVRSGWDELV
FAGGVESMSRVPMGSDGGALALDPESNFYNDFIPQGISADIIASLDGMTREDLDAFAARS
HERAAKAWEEGRFDRTVVPVKDQNGQVLLDRDETIRQGTTVESLSGLRPAFAMIGDQGGF
DAVAQTKYPQLERINHLHHAGNSSGIVDGAALLAIGSEKAGQEMDLEPRARVVSVATTGV
EPTIMLTAPAPASRAALAKAGLKPEDIDVWEINEAFSSVVLRAQRELNIPDEKLNISGGA
IAMGHPLGATGAIITGNAIDELHRTGGRYALITLCVAAGMGVATIIERV
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgacgagtaactctggcgcccctgaggccttcatctacgacgccgtccggacgccccgc
ggaaagggcaagcccggcggatccctgcacaccgtcaagccggtcagcctgctcagcggg
ctgatcgaggccatcctggagcgcaacccgggcctggacccggcgcgcatcaacgatgtc
atcgcgggctgcgtgacccccgtcggcgaccagggcatggacatcgcccgcaccgcggcc
ctcaacgccggcctgccgtactccgcgaccggactgcaggtcaaccgctactgcgcatcc
ggcctgaccgccctcaacctcgccgcgcagaaggtgcgttccggctgggatgagctcgtc
ttcgctggtggcgtggagtccatgtcccgcgtgccgatgggttccgatggtggtgccctc
gccctcgacccggagtccaacttctacaacgacttcatcccgcagggcatctccgcggac
atcatcgccagcctcgacgggatgacccgcgaggacctcgacgccttcgccgctcgctcc
cacgagcgcgccgccaaggcctgggaggagggccgcttcgaccgcaccgtcgtcccggtc
aaggaccagaacggccaggtgctgctggaccgcgacgagaccatccgtcagggcaccacc
gtggagtccctctccggcctgcgcccagccttcgccatgatcggcgaccagggcggcttc
gacgccgtcgcgcagacgaagtacccgcagctcgagcgcatcaaccacctgcaccacgcc
ggtaactcctccggcatcgtcgacggcgcagccctgctggccatcggctccgagaaggcg
ggtcaggagatggatctcgagccgcgcgcccgcgtcgtctccgtcgccaccaccggcgtg
gagccgaccatcatgctcaccgcaccggcaccggcgtcccgcgccgcactggccaaggcc
ggcctgaagccggaggacatcgacgtctgggagatcaacgaggcattctcctccgtcgtc
ctgcgcgcacagcgcgagctgaacatcccggatgagaagctcaacatcagcggtggcgcc
atcgccatgggccacccgctgggcgcgaccggcgcgatcatcaccggtaatgcaatcgac
gagctgcaccgcaccggcggccgctacgcactgatcaccctgtgcgtcgcagccggcatg
ggcgtggccaccatcatcgagcgcgtctaa

DBGET integrated database retrieval system