KEGG   Corynebacterium urealyticum DSM 7109: cu0217Help
Entry
cu0217            CDS       T00685                                 

Definition
(GenBank) putative exopolyphosphatase
  KO
K01524  exopolyphosphatase / guanosine-5'-triphosphate,3'-diphosphate pyrophosphatase [EC:3.6.1.11 3.6.1.40]
Organism
cur  Corynebacterium urealyticum DSM 7109
Pathway
cur00230  Purine metabolism
cur01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cur00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    cu0217
Enzymes [BR:cur01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.11  exopolyphosphatase
     cu0217
    3.6.1.40  guanosine-5'-triphosphate,3'-diphosphate phosphatase
     cu0217
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ppx-GppA
Motif
Other DBs
NCBI-ProteinID: CAQ04177
UniProt: B1VEI8
Position
271213..272151
Genome map
AA seq 312 aa AA seqDB search
MRLGVLDVGSNTVHLVVVDAQYGGPPTPMSNWKTPMRLVEYLSKKGNINSKGIDKLTRGV
GLASEMAEQFRCEELLPFATSAIRSANNSEKVLDAVEDATGVRLRILTGEEEARLTFLAV
RRWYGWSAGRICDLDIGGGSLEMSVGTTESPDVALSLDLGAGRLTREWFDSDPPSRKSVK
NLREFIEDQLDANIKEFQEAGPIDVAVGTSKTFRMLARLTGAAPSSAGPRVKRTLTQPGL
RQLIAFISRMTAADRAELEGVSQERSHQVVAGALVAEAAMRKLGLESLDICPWALREGMI
FHHTDVAFEDFS
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
gtgagattaggtgtcttggacgttggcagtaatacggttcacctcgtggttgtggatgcc
cagtacggtggcccgccaactcccatgagtaattggaaaacccccatgcggttggtggag
tacctctcgaagaaggggaacatcaactcgaaggggatcgataagctcacgcgtggcgtt
gggttggcttcggagatggcggagcagttccgctgtgaggagctgctgccgtttgcgacg
tcggcgatccgttccgcgaataattccgaaaaggtgctggacgctgtcgaggacgccact
ggcgtgcggctgcgaatccttacgggcgaagaagaagcccgactgaccttcctcgcggtg
cgccgctggtacggctggtcggccggccgcatttgcgacctcgacatcggcgggggttcc
ctggagatgtccgtgggaaccaccgagagcccggacgtggcactgagcctggatctgggt
gcggggcggctgacccgggaatggttcgacagtgatccgccgtcccggaagtccgtgaag
aacctgcgggagttcatcgaagatcagctggacgccaatatcaaggagttccaggaggcc
ggcccgatcgatgtggcggtggggacctccaagactttccgtatgcttgcccgcttgact
ggtgcagcaccgagctctgcggggccacgggtgaagcgcaccctgacccagcctggcctg
cggcagctcatcgctttcatctcccgcatgaccgcggcggaccgggcggagctggaggga
gtgagccaggaacgttcccatcaggtggtggctggcgcgctggtcgcggaggcggcgatg
cgcaagttgggcctggagtccttggatatttgcccatgggcgctacgtgagggaatgatc
ttccaccacacggatgtagcgtttgaagatttttcttag

DBGET integrated database retrieval system