KEGG   Corynebacterium urealyticum DSM 7109: cu0232Help
Entry
cu0232            CDS       T00685                                 

Definition
(GenBank) unnamed protein product
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
cur  Corynebacterium urealyticum DSM 7109
Pathway
cur00860  Porphyrin and chlorophyll metabolism
cur01100  Metabolic pathways
cur01110  Biosynthesis of secondary metabolites
cur01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cur00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    cu0232
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cur01007]
    cu0232
Enzymes [BR:cur01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     cu0232
Amino acid related enzymes [BR:cur01007]
 Aminotransferase (transaminase)
  Class III
   cu0232
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 DUF421
Motif
Other DBs
NCBI-ProteinID: CAQ04192
UniProt: B1VEK3
Position
290099..291442
Genome map
AA seq 447 aa AA seqDB search
MASTNTNVNAAAEERHHESAAAMERARRFIPGGVNSPVRAFGSVGGTSPFITSASGSQLQ
DADGLSYVDLVCSWGPMIHGHAHPEIVEAVKSTASRGLSFGAPTSLEVDLAEEIVNRTSV
EKVRLVNSGTEATMSAVRLARGFTGRDKILKFEGCYHGHVDSLLVAAGSGVATFGLPDSP
GITKAAASDTVVVPYRDIEAVKKAFAENEGQIAAIITEATPGNMGTVSSITADGTSFNAQ
LKEIAHANGALLIVDEVMTGFRVGYQGWFGKDGVAGDLTTFGKVVSGGLPAAAFGGRADI
MDHLAPVGPVYQAGTLSGNPVAMASGLASLKLADEDAYRTLDANAERLIGLITEALNRES
VEHHIQRAGTMFSVRFADGEGTNFGEMKAADTFRYPAFFHELLDNGIFAPPSVFETWFVS
TALTDADFERFEAALVPAAKAAAAAEA
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atggcttcgaccaacaccaacgtcaacgcggcagccgaggagcgccaccacgagagcgcg
gcggcgatggagcgggcacgccgcttcatcccagggggtgtgaactccccggtgcgcgcc
ttcggctctgtcggcgggacctccccgttcatcacctccgcctccggctcccagctgcag
gatgccgatggcctcagctacgtggacctggtgtgctcctgggggccgatgatccacggg
cacgcccacccggagatcgtcgaggccgtgaagtcgaccgcctcccgcggcctgtccttc
ggcgccccgacctccctggaggtcgacctggctgaggagatcgtcaaccgcacgagcgtg
gagaaggtccgcctggtcaactccggcaccgaggccaccatgtccgccgtgcgcctggcc
cgtggcttcaccggtcgcgacaagatcctgaagttcgagggctgctaccacggccacgtg
gactccctgctcgtcgccgccggctctggcgtggccaccttcggcctgccggactccccg
ggcatcaccaaagccgccgccagcgacaccgtcgtggtgccgtaccgcgacatcgaggcc
gtcaagaaggcatttgcggagaacgagggccagatcgccgccatcatcaccgaggccacc
ccgggcaacatgggcaccgtttcctccatcaccgcggacggcaccagcttcaacgcccag
ctcaaggagattgcgcacgccaacggcgcgctgctcatcgtcgacgaggtcatgaccggc
ttccgcgtgggctaccagggctggttcggcaaggacggcgtggccggcgacctcacgacc
ttcggcaaggtcgtctccggtggcctgcctgccgcggccttcggcggccgtgccgacatc
atggaccacctggccccggtcggcccggtgtaccaggccggcaccctctccggtaacccg
gtcgcgatggccagcgggctggcgtcgttgaagctggcggacgaggacgcctaccgcacc
ctggacgccaacgctgagcgcctgatcggcctgatcaccgaagcactgaaccgcgaatcc
gtggagcaccatatccagcgtgccgggacgatgttctccgtgcgcttcgcagacggcgaa
ggcaccaacttcggggagatgaaggccgcggacaccttccgctacccggccttcttccac
gagctgctggacaacggcatcttcgccccgccgagcgtattcgagacctggttcgtctcc
accgcgctgacggacgcggacttcgagcgtttcgaggccgccctcgtgccagcagcgaag
gccgccgcagccgcggaggcttag

DBGET integrated database retrieval system