KEGG   Corynebacterium urealyticum DSM 7109: cu1249Help
Entry
cu1249            CDS       T00685                                 

Definition
(GenBank) lipoic acid synthetase
  KO
K03644  lipoyl synthase [EC:2.8.1.8]
Organism
cur  Corynebacterium urealyticum DSM 7109
Pathway
cur00785  Lipoic acid metabolism
cur01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cur00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00785 Lipoic acid metabolism
    cu1249
Enzymes [BR:cur01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.8  lipoyl synthase
     cu1249
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM LIAS_N
Motif
Other DBs
NCBI-ProteinID: CAQ05209
UniProt: B1VHG8
Position
1474234..1475277
Genome map
AA seq 347 aa AA seqDB search
MTVSANGRRMLRIEAKNSQTPIEAKPRWIRTTAKMGPEYRDMKNRVTGMSLHTVCQEAGC
PNIHECWEDREASFLIGGDTCSRRCDFCQIKSGKPTPLDRDEPRRVAESVREMGLKYATV
TGVTRDDLDDEGAWLYAEVVRKIHELNPNTGVENLTPDFSNKPELLQIVFESQPEVFAHN
LETVPRIFKRIRPAFKYERSLEVIRAAHDYGLITKSNLILGMGETEEEVVEAMRDLREAG
TDILTITQYLRPTSMHHPIERWVRPEEFVAHSEAAYDMGFPAVMSGPLVRSSYRSGRLYA
QAMRARGREIPENLSHLNEKLDGSTQQEATNLLDKYGASEETPVAYR
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgactgtcagcgctaatggacgccggatgcttcgcatcgaagctaagaactcgcaaact
cccatcgaggctaagccccgctggatccgcaccaccgcgaagatgggccccgagtatcgg
gacatgaagaaccgcgtgacgggcatgagcctgcacacggtgtgccaggaggctggctgc
ccgaatatccacgagtgctgggaggaccgcgaggcctccttccttatcggcggcgatact
tgctctcgccgttgcgacttctgccagattaagtccggtaagcccactcccctggaccgc
gatgagccacgccgcgtggcggagtccgtccgcgagatgggcctgaagtacgcaaccgtc
acgggcgtgacccgcgacgacctggacgacgagggcgcctggctgtacgccgaggtcgtc
cgcaagatccacgagctgaacccgaacacgggcgtggagaacctcaccccggacttctcg
aataagccggagctgctgcagatcgtgttcgagtctcagccggaggtcttcgcccacaac
ctggagaccgtgccgcgcatcttcaagcgcatccgcccggccttcaagtacgagcgctcc
ctggaggtcatccgtgcggctcacgattacgggctgatcacgaagtccaacctgatcctg
ggcatgggcgagaccgaggaggaggttgtggaggcgatgcgtgacctgcgcgaggccggc
accgatatcctcacgattacccagtacctgcgcccgacctccatgcaccacccgatcgag
cggtgggtgcgcccggaggagttcgtggcacactccgaggctgcttatgacatgggcttc
ccggctgttatgtccggcccgctggttcgttccagctaccgctccggccgcctgtacgcg
caggcgatgcgcgcacgtggccgtgagatcccagaaaacctctcccacctcaacgagaag
ctggacggctccacccagcaggaggccaccaacctgctggataagtacggcgcatccgag
gagaccccggtcgcataccgctag

DBGET integrated database retrieval system