KEGG   Corynebacterium urealyticum DSM 7109: cu1605Help
Entry
cu1605            CDS       T00685                                 

Gene name
cat1
Definition
(GenBank) succinyl-CoA:coenzyme A transferase
  KO
K18118  succinyl-CoA:acetate CoA-transferase [EC:2.8.3.18]
Organism
cur  Corynebacterium urealyticum DSM 7109
Pathway
cur00020  Citrate cycle (TCA cycle)
cur00620  Pyruvate metabolism
cur00650  Butanoate metabolism
cur01100  Metabolic pathways
cur01110  Biosynthesis of secondary metabolites
cur01120  Microbial metabolism in diverse environments
cur01130  Biosynthesis of antibiotics
cur01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cur00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    cu1605 (cat1)
   00620 Pyruvate metabolism
    cu1605 (cat1)
   00650 Butanoate metabolism
    cu1605 (cat1)
Enzymes [BR:cur01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.18  succinyl-CoA:acetate CoA-transferase
     cu1605 (cat1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetylCoA_hydro AcetylCoA_hyd_C CoA_trans Phage_rep_org_N
Motif
Other DBs
NCBI-ProteinID: CAQ05565
UniProt: B1VII1
Position
complement(1872145..1873650)
Genome map
AA seq 501 aa AA seqDB search
MTDRIAHEQLKSKVMSAEEAAQFVNNGDKVGMSGFTGAGYPKALPTAIANKAKDAHSRGE
DFKIDVFTGASTAPDCDGVLAEAEAVNYRAPYASDPIMRKAINAGEMKYQDIHLSHMGLQ
VEQGFFGKFDVAIIEAVRITEEGNIVPSSAVGNNVEYINAADKVIIEINEWQSEDLEGMH
DIWSMPALPNRTPIPINKPGDRIGTTYIPIESSKVVAVVKTNAPDRNAPFKPVDETSEQI
AGHFLDLLEGEVKAGRLTYDGYIMQSGVGNVPNAVMAGLLDSKFENIQAYTEVIQDGMLD
LIDAGKMTVASATSFALSPEYAEKMNAEAKKYRESIILRPQQISNHPEVVRRTGLISSNG
MIEADIYGNVNSTNVSGSRIMNGIGGSGDFTRNAFLSTFISGTIAKDGAISTIVPFASHI
DHTEHDAMVIITERGYADLRGLAPRDRVKKMIEIAHPDYQPLLEEYYERAKSKGTGLQTP
HDLATAFDFHINLAEKGSMKG
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgacagatcgcattgcccatgagcagctcaagtccaaggtgatgagcgccgaggaggcg
gcacagttcgtcaataatggcgacaaggtcggcatgtccggctttaccggtgccggctac
ccgaaggccctccccaccgccatcgctaataaggcgaaggacgcccactcccgtggcgag
gacttcaagatcgacgtcttcacgggtgcttccacggccccggactgtgatggtgtgctc
gccgaggcagaggccgtcaactaccgcgcgccttatgcttccgacccgatcatgcgcaag
gccatcaacgctggcgagatgaagtaccaggacatccacctctcccacatgggtttgcag
gtggagcagggcttcttcggcaagtttgatgtcgccatcatcgaggccgttcgcatcact
gaggagggcaacatcgtgccgtcctccgcggtgggtaacaacgttgagtacatcaacgcc
gcggacaaggtcatcatcgagatcaacgagtggcagtccgaggatctcgagggcatgcac
gacatctggtcgatgccggcgctgccgaaccgcaccccgatcccgatcaacaagccgggc
gaccgcatcggtaccacctacatcccgatcgagtcctccaaggttgtcgcggtcgtgaag
accaacgcgccggaccgcaacgctccgttcaagccggtggacgagacctccgagcagatc
gctggccacttcctcgacctgctcgagggtgaggtgaaggccggccgcctgacctacgac
ggctacatcatgcagtccggcgtgggtaacgtccctaacgccgtgatggcgggcctgctg
gactccaagttcgagaacatccaggcctacaccgaggtcattcaggacggcatgctcgac
ctgatcgacgcgggcaagatgaccgttgcttccgcaacttccttcgctctctccccggag
tacgcggagaagatgaacgcagaggcgaagaagtaccgcgagtccatcatcctgcgcccg
cagcagatctctaaccacccagaggttgtgcgccgcacgggcctgatttcctccaacggc
atgatcgaggcggacatctacggcaacgtgaactccacgaacgtctccggctcccgcatc
atgaacggcattggcggttccggtgacttcacccgaaacgccttcctgtcgaccttcatc
tcgggcacgatcgccaaggacggcgcgatctccacgatcgttcctttcgcatcccacatc
gaccacaccgagcacgacgccatggtcatcatcaccgagcgtggctacgccgacctgcgt
ggcctggcgccgcgcgaccgtgtgaagaagatgatcgagatcgctcacccggattaccag
ccgctgctggaggagtactacgagcgcgcgaagtccaagggcactggcctgcagaccccg
cacgatctggccaccgcttttgatttccacatcaacctggcggagaagggcagcatgaag
ggctag

DBGET integrated database retrieval system