KEGG   Corynebacterium ulcerans FRC11: CulFRC11_1125Help
Entry
CulFRC11_1125     CDS       T03408                                 

Gene name
fhs
Definition
(GenBank) Formate--tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
cus  Corynebacterium ulcerans FRC11
Pathway
cus00670  One carbon pool by folate
cus01100  Metabolic pathways
cus01120  Microbial metabolism in diverse environments
cus01200  Carbon metabolism
Module
cus_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:cus00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    CulFRC11_1125 (fhs)
Enzymes [BR:cus01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     CulFRC11_1125 (fhs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS DUF3563
Motif
Other DBs
NCBI-ProteinID: AIU32702
Position
complement(1223473..1225122)
Genome map
AA seq 549 aa AA seqDB search
MPSDVQIAQAHTLEPIVDIATRAGISTEALIPYGKTKAKVDITAEELQPDGKLVLVTGMS
PTPAGEGKSTVLIGLSDAMRLRGHNAIVAIREPSLGPVMGIKGGAAGGGYSQIVPMEDIN
LHFTGDFHAITSANNTLAAMIDNHIQQGNELGIDARRITWQRCLDVNDRSLRNVVTGLGG
KPHGTPTQTGFTITAASEIMAILCLSTDLSDLEKRISRIVIGQSFDGKPITVKELNAQGA
MTALLRDAINPNLVQTLGGTPAFCHGGPFANIAHGCNSLIATKTALHYGDVVLTEAGFGS
DLGAEKFFDIKMRAGELSASAVVIVATIRSLKYNGGVAKDQLTSENLDALKQGIVNLERH
VENIRNFGVEPVVALNMFTSDTTAEQKYMEDWAAGFGVRLIPVQVWAKGGEGALELADAV
ADMLGQSSEPLYDPSQGLEASLETIATKVYGAKEVMLSKEAQRDLDYLKDNGWDTLPVCI
SKTQYSFSDDPTELGRPEGHILHVRSLLPRIGAGFILALTGDVMTMPGLPKRPAAEKITV
ENGNIHGLF
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgccctcagacgtccagatcgcccaggctcacactctggagcccatcgttgacattgca
acgcgtgctggaatcagcacagaagctctcattccttacggcaaaacaaaagccaaagtt
gatatcactgcagaagaactccaaccagatggcaagctcgtgctagtaactggtatgtcc
ccaacccctgcaggagaaggtaaatccactgtcttgatcggcctctccgatgcgatgcgg
ttgcgcggacacaacgccattgttgctatccgggagccttccctcggcccagtcatgggg
atcaaaggtggtgctgctggaggtggatattctcagatcgtgcccatggaggacattaac
cttcattttacgggtgatttccacgcgattacatccgcgaataacacccttgcagcaatg
atcgataatcatattcagcagggtaacgagctaggtatcgacgcacgacgtattacgtgg
cagcgctgcttggacgttaacgatcgctcgctgcgcaacgttgtcaccggtcttggtggg
aagcctcatggcacgcctacccagaccggttttacaattacggctgcaagcgaaatcatg
gcgattctatgcttgtccaccgacttatcggatttggaaaagcggatctctcgtatcgtg
atcggacagagctttgacggtaaaccgatcactgtaaaagagctgaacgcacagggtgca
atgacggctttgctgcgcgatgcgattaaccccaacctcgttcaaacccttggcggaacc
cccgctttttgccatggcgggccttttgccaatattgctcacggttgtaactctcttatt
gcaaccaagactgctttgcattatggtgatgtcgttcttacggaggccggttttgggtcc
gatcttggtgcagaaaagttctttgatatcaagatgcgagcaggagagctctcggcttca
gctgtagtcatcgttgctactatccgatctttgaaatataacggtggtgttgccaaagac
cagctcacctcagagaaccttgacgctctcaagcagggaatagtcaaccttgagcggcac
gtagaaaacattagaaactttggtgtggagcctgttgtagcgctcaacatgtttacctct
gataccaccgcagagcagaagtatatggaagattgggcggctggctttggggtgcgattg
attccagtgcaggtctgggctaagggaggggaaggggctcttgagctcgccgatgcggtg
gccgacatgctgggacaatcttctgaaccgctctatgacccaagccaaggactggaggct
tctttagagactatcgctacaaaagtctatggcgctaaagaggtcatgttgagcaaagaa
gcacagcgagaccttgactatctcaaggacaacggctgggatacgcttcccgtgtgcatc
tcaaaaacccagtattcctttagcgatgatcccacggagttaggtcgtcccgaagggcac
atactgcacgtgagaagcttgctgcctcggattggtgctgggttcatcctggcgctcact
ggtgacgtcatgacgatgccaggcttgcccaagcgcccagcagccgagaagatcaccgta
gaaaacggaaacatccacggtttgttctag

DBGET integrated database retrieval system