KEGG   Corynebacterium ulcerans FRC11: CulFRC11_1376Help
Entry
CulFRC11_1376     CDS       T03408                                 

Gene name
mqo
Definition
(GenBank) Malate:quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
cus  Corynebacterium ulcerans FRC11
Pathway
cus00020  Citrate cycle (TCA cycle)
cus00620  Pyruvate metabolism
cus01100  Metabolic pathways
cus01110  Biosynthesis of secondary metabolites
cus01120  Microbial metabolism in diverse environments
cus01130  Biosynthesis of antibiotics
cus01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cus00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CulFRC11_1376 (mqo)
   00620 Pyruvate metabolism
    CulFRC11_1376 (mqo)
Enzymes [BR:cus01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     CulFRC11_1376 (mqo)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO Pyr_redox_2 FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AIU32945
Position
complement(1501791..1503296)
Genome map
AA seq 501 aa AA seqDB search
MNMADSINAQRVTDEVDVALIGGGIMSATLGAMLRTLEPSWSQVLFERLDAPAQESSSPW
NNAGTGHSALCELNYTPEVNGRIEINKALGVNEKFQVSRQFWSYQINQGVLPNPREWINP
VPHVSFARGEAQVNYLKKRYDALANHPLFPNMQYTDDRSVFNDMLPLMADGRSEFEKVAI
SWTDAGTDINYGSQTRQFLKAAEANGTNIRYGHEVKDITRDGGKWKIKVKNVHTGDIQVI
RANFVFVGAGGMALPLLQKSGIPEIRGWGGFPVSGQWLRCTNQEVIEQHSAKVYGKASIG
APPMSVPHLDTRVIDGEKGLLFGPYAGWTPKFLKKGSYFDLVKSIRPTNLMSYLGVGAQE
FGLTKYLITEVLKDQSARMESLREYMPNARDEDWELITAGQRVQAIEPVVGPRFSSLAFG
TSLINSADGSIAGILGASPGASIAPAAMLELLERCFGQRMVEWGDKIKEMIPSYGIKLAT
DKRLFEEIWDYTQTTLQLDQD
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
ttgaatatggcagattccatcaacgcgcaacgggtcacggacgaagtagacgttgccctg
atcggcggcggcatcatgagtgccacccttggcgctatgctccgcacacttgaacctagc
tggtctcaggtcctctttgagcgtctcgatgcacctgctcaagagtcatcctcgccgtgg
aacaacgcagggacagggcattcggctctgtgcgagctgaattacacgccggaagttaat
gggcgtattgaaatcaataaagctctgggcgtaaatgaaaagttccaagtttctcgccag
ttctggtcttatcaaattaaccaaggggtcctgccgaatcctcgcgagtggattaaccct
gtacctcacgtttcctttgctcgtggtgaagcgcaggttaactatttgaaaaagcgttac
gacgccctagctaaccatccgctgttccccaacatgcaatacacggacgaccgtagtgtg
ttcaatgacatgctgccgctgatggctgatggacgcagcgaatttgagaaggtcgcgatt
tcctggactgacgctggcacggacattaactatggatcgcaaactcgtcagttcctcaaa
gcagccgaggctaatggcaccaatatccgttatggtcacgaggttaaagacattactcgt
gatggcggtaagtggaagattaaagtcaaaaacgttcacaccggtgatattcaggttatc
cgtgcgaactttgtctttgtaggcgctggtggaatggcactcccgctgctccaaaagtct
ggtattccggaaatacgtgggtggggcggtttccccgtgtccggtcagtggctgcgctgt
actaaccaagaagtcatagagcagcattcggcgaaggtttatggcaaagcatctatcggt
gcgcctccgatgtcggtgccgcatttggatacccgcgtcattgatggagaaaaaggcctg
ctgtttgggccttatgcaggatggacgccaaaattcttaaagaagggctcgtacttcgat
cttgttaagtcgatccgtcccacaaacctgatgtcttatctaggcgttggggcgcaggaa
tttggcctgactaagtacctcatcactgaggtacttaaggaccagtcggctcggatggag
tctctgcgcgagtacatgcctaatgcgcgcgatgaagactgggaactgattacagccggt
cagcgtgtacaggctatcgagcccgttgtggggccgcgattctcctctttggcttttggt
acttcccttattaactccgctgatgggtctatcgctggcattcttggcgcatcgccagga
gcctctattgcaccagccgcgatgttggaactgcttgagcgttgcttcggtcagcgcatg
gtcgaatggggcgacaagattaaggaaatgattccttcctatggaattaagcttgctacg
gataagcgactatttgaagagatttgggattatacccagacaactctgcagcttgatcaa
gactaa

DBGET integrated database retrieval system