KEGG   Corynebacterium ulcerans FRC11: CulFRC11_2005Help
Entry
CulFRC11_2005     CDS       T03408                                 

Gene name
pitB
Definition
(GenBank) Phosphate permease
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
cus  Corynebacterium ulcerans FRC11
Brite
KEGG Orthology (KO) [BR:cus00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    CulFRC11_2005 (pitB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AIU33554
Position
complement(2193263..2194867)
Genome map
AA seq 534 aa AA seqDB search
MADSTMLTTPSTEGAGSDRWWHLTFGGLLAITLIVFTLWSFGYVGDTANKGILITTILFG
VFMAFNIGGNDVANSFGTSVGAGTLTMKQALVIAAIFEVSGAVLAGGEVTDTVKSGIVDL
DAIDLSPHHFAFIMMASLLGAAVWLLLATRMGWPVSTTHSIIGGIVGASLVLGFTQGLGG
WEMVQWGEIGQIALSWVLSPVLGGLAAWLLFGFIKRHILVYNEDADEQLRQIKSDRIELH
KSFKASFERLNEIQQLAYTNAMTRDAALIQERDFDPSELESEYYRDLYRINHRRDNLNTH
QALENWVPLLAAGGAALIGAMMLFKGLKNLNLHISTLGNILILGMISAVVWMAVLIFSRT
LKQQELSRATFVIFSWMQVFTASAFAFSHGSNDIANAIGPFSAVLDVLRTDSINGKAAVP
TALMVTCGVALIAGLWFIGRYVIHTVGSGLTEMHPASGFSAELAAAAVVMGSSVLGLPVS
STHILIGAILGIGIVNKAANWRLMKPIAMAWVITLPAAAFVSGMAVLVLNAIWG
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atggcggacagcactatgctgaccacaccgtccactgagggcgccggttcagatcgatgg
tggcaccttacttttggtggactcttggcgattacgctgattgttttcaccctgtggtca
ttcggctacgtgggcgataccgctaacaagggtattttgatcaccacaatattgtttggt
gttttcatggccttcaatattggcggtaatgacgtagctaattcctttggcacctctgtg
ggtgcggggaccctcaccatgaagcaagccctggttattgcggccatttttgaagtttct
ggtgcggttcttgcaggcggtgaggttaccgatacggtgaaatccgggatcgtggatctt
gacgccatcgatttaagcccgcaccattttgctttcattatgatggcgtctcttctgggg
gctgcagtgtggttgttgctggctacccggatgggatggccggtgtctactacccactcg
atcattggtggcattgtgggagcatccctagtgctgggctttactcagggcctcggcggc
tgggaaatggtgcaatggggagaaatcggtcagatcgcgttgtcatgggttctctctccc
gtgttggggggcctggctgcgtggctgttgttcgggtttattaaaaggcacattctggtt
tataacgaagatgcggacgagcaattgcggcaaattaagtctgaccgcattgagctccac
aagtctttcaaggcgtcttttgagcgcttgaatgagattcagcagctcgcgtataccaat
gccatgacgcgcgacgctgcgttgatccaggagcgcgattttgatcctagtgagctggag
tccgagtattatcgcgatctctatcgtattaaccaccgccgcgataacctcaacacccat
caggccctggaaaattgggtccccttgcttgctgcaggtggagcggctctgatcggtgcg
atgatgctctttaaggggctgaaaaaccttaacttgcacatcagtacgttggggaacatc
ctgattcttgggatgatctctgccgttgtgtggatggcagtgctgattttttctcggacc
ctcaaacagcaagaactctcgcgagcaacgtttgtcatcttctcctggatgcaagtcttt
acggcatcggcattcgccttttcccacggttctaatgacatcgcgaatgcgattggcccg
ttctctgcagtgctagatgtcttgcggactgacagtattaacggcaaggctgctgttcct
accgcactgatggttacctgcggtgtcgcgttgatcgctggcctgtggtttatcgggcgc
tatgtgatccatacggtgggatcggggcttacggagatgcatccggcgtccgggttctcg
gctgagttggctgcggctgcggtcgtgatgggttcctctgtccttggacttcccgtgtct
tctacgcatattttgatcggtgcaattctgggtatcggcattgtgaacaaagctgccaac
tggcgcctgatgaagcccatcgcgatggcgtgggtgatcacgcttccggctgcggctttt
gtatccggtatggccgtgcttgttttgaatgctatttggggttaa

DBGET integrated database retrieval system