KEGG   Cupriavidus sp. USMAA2-4: BKK79_00600Help
Entry
BKK79_00600       CDS       T05072                                 

Definition
(GenBank) two-component system response regulator OmpR
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
cuu  Cupriavidus sp. USMAA2-4
Pathway
cuu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cuu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BKK79_00600
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:cuu02022]
    BKK79_00600
Two-component system [BR:cuu02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   BKK79_00600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C
Motif
Other DBs
NCBI-ProteinID: AOY90494
UniProt: A0A1D9GSF6
Position
1:complement(118907..119629)
Genome map
AA seq 240 aa AA seqDB search
MENTSHKILVVDDDPRLRDLLRRYLGEQGFTVLVAENATAMNKLWLRERFDLLVLDLMMP
GEDGLSICRRLRGANDQTPIIMLTAKGEDVDRIVGLEMGADDYLPKPFNPRELIARIHAV
LRRKGPAEVPGAPSETPETFAFGDFVLNLATRTLTKNDEEITLTTGEFSVLKVFARHPRQ
PLSREKLMEMARGREYEVFDRSLDVQISRLRKLIEPDPGNPRFIQTVWGLGYVFIPDGVK
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atggaaaataccagccacaagattcttgtcgtggacgatgatccgcgtctgcgcgacctg
ctgcgccgctatctgggcgagcagggcttcacggtgctggtggcggagaacgccaccgcc
atgaacaagctctggctgcgcgaacgcttcgacctgctggtgctcgacctgatgatgccc
ggcgaagacggcctgtcgatctgccgccggctgcgcggtgccaacgaccagacgcccatc
atcatgctgaccgccaagggcgaggatgtcgaccgcatcgtcggcctcgaaatgggcgcc
gacgactacctgcccaagccgttcaacccgcgcgagctgatcgcgcgcatccacgccgtg
ctgcgccgcaagggcccggccgaagtcccgggcgcgccgtccgagacgccggaaaccttc
gccttcggcgacttcgtcctcaacctggccacccgcacgctgaccaagaacgacgaggaa
atcaccctcaccaccggcgagttctcggtactgaaggtgttcgcccgccatccgcgccag
ccgctgtcacgcgagaagctgatggaaatggcgcgcggccgcgagtacgaggtgttcgat
cgcagcctggacgtgcagatctcgcgcctgcgcaagctgatcgaaccggacccgggcaac
ccgcgcttcatccagacggtctggggcctcggctacgtcttcatccccgacggcgtcaag
tga

DBGET integrated database retrieval system