KEGG   Cupriavidus sp. USMAA2-4: BKK79_02590Help
Entry
BKK79_02590       CDS       T05072                                 

Definition
(GenBank) amidase
  KO
K01426  amidase [EC:3.5.1.4]
Organism
cuu  Cupriavidus sp. USMAA2-4
Pathway
cuu00330  Arginine and proline metabolism
cuu00360  Phenylalanine metabolism
cuu00380  Tryptophan metabolism
cuu00627  Aminobenzoate degradation
cuu00643  Styrene degradation
cuu01100  Metabolic pathways
cuu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cuu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    BKK79_02590
   00360 Phenylalanine metabolism
    BKK79_02590
   00380 Tryptophan metabolism
    BKK79_02590
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BKK79_02590
   00643 Styrene degradation
    BKK79_02590
Enzymes [BR:cuu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.4  amidase
     BKK79_02590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AOY90823
UniProt: A0A1D9GT63
Position
1:588554..589978
Genome map
AA seq 474 aa AA seqDB search
MQISDYASLDATALAQQIRAGHVSASEVMEAARAAARQLNPALNALIDIFPAALEHASEG
PFAGVPFLLKDLVLHARGIPCDSGSRMTGGGIVPATDSELMARFRRAGFAAFGRTATPEF
GFNATTECRLHGPTRNPWEPGHSAGGSSGGAAAAVAAGIVPVAHANDGGGSIRIPAAACG
LVGLKPSRGRTPAGPDYGLPLLGLGIEFVLTRTVRDCAAVLDAVSGPDSGAPFRIEAPAL
PYADAIAAPLRRLRVAVSTRFPGSAETHPDCIAATLQAARTLESMGHHVEFASPEYCAES
LASANRTAWTSFLAAAALGTGQAIGRPYDGSGVEACTRACIEHGLALKALDLELALAGMN
AVSRALGGFFERYDLLVTPVTRVPTVPLGYLDQDDATLDARGWCDKVFDYCPFTPLFNVT
GTPALSLPLGMSGGLPLGVQFAAPMCDEATLLQVAAALEQAMPWRERRPRLYAA
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgcaaatcagcgactacgcaagcctggacgcgaccgcgctcgcgcagcagatccgtgcc
ggacatgtgtccgcaagcgaagtcatggaagcggcgcgggccgcggcccggcagctcaat
ccagcgctcaacgccctgatcgacatcttccccgccgcgctggaacatgcgagcgagggc
cccttcgccggcgtccccttcctgctcaaggacctggtgctgcatgcgcgcggcattccc
tgcgacagcggttcgcgcatgacgggcgggggcatcgtcccggccaccgattccgagctg
atggcgcgcttccgccgcgccggcttcgctgccttcggccgcaccgccacgccggagttc
ggcttcaatgccaccaccgaatgccgcttgcacggccccacccgcaatccttgggaaccc
gggcacagcgcgggcggctccagcggtggcgcggccgccgccgtggccgccggcatcgtc
ccggtggcgcacgccaatgacggtggcggctcgatccgcatcccggcggccgcctgcggg
ctggtcggtctcaaaccctcgcgcgggcgcacgcccgccgggcccgactacggcctgccc
ctgctgggcctgggcatcgagttcgtgctgacgcgcaccgtgcgcgactgcgccgcggtc
ctcgatgccgtgagcggacccgacagcggcgcgccgttccgcatcgaagcaccggcgctg
ccctacgcggacgccattgccgccccgttgcggcgcctgcgcgtcgccgtctcgacgcgc
ttcccgggcagcgccgaaacccaccccgattgcattgccgccacgctgcaagcggcgcgt
accctggaatcgatgggccaccacgtggagttcgccagcccggagtactgtgcggaatca
ctggccagcgccaaccggacggcctggacgtcgttcctggccgccgcggcgctaggcacc
ggccaggccatcggccggccctacgacggcagcggcgtggaagcctgcacgcgcgcctgc
atcgagcacggcctggcactgaaggcgctcgacctggaactggccctggccggcatgaac
gccgtttcacgcgcgctcggcggcttcttcgagcgctacgacctgctggtcacccccgtc
acgcgcgtgccgaccgtgccgctcggctacctggaccaggacgatgccacgctcgatgcg
cgcggctggtgtgacaaggtgttcgactactgccccttcacgcccttgttcaatgtcacc
ggcacgccggcgctgtcgctgccgctcggcatgtcgggcgggctgccgctcggcgtgcag
tttgccgcgccgatgtgcgatgaagccacgctgctgcaggtggcggccgcgctggaacag
gcgatgccttggcgcgagcgccgtccgcgcctgtatgccgcctga

DBGET integrated database retrieval system