KEGG   Cupriavidus sp. USMAA2-4: BKK79_17535Help
Entry
BKK79_17535       CDS       T05072                                 

Definition
(GenBank) glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
cuu  Cupriavidus sp. USMAA2-4
Pathway
cuu00471  D-Glutamine and D-glutamate metabolism
cuu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cuu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    BKK79_17535
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cuu01011]
    BKK79_17535
Enzymes [BR:cuu01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     BKK79_17535
Peptidoglycan biosynthesis and degradation proteins [BR:cuu01011]
 Precursor biosynthesis
  Racemase
   BKK79_17535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race His_Phos_1 EccE
Motif
Other DBs
NCBI-ProteinID: AOY93401
UniProt: A0A1D9H0S9
Position
1:complement(3931333..3932178)
Genome map
AA seq 281 aa AA seqDB search
MNQPANDAPIGIFDSGLGGLSVLREIRALLPHESLLYIADSKYAPYGEKPERFVEARTLQ
VCRWLADQGCKALVIACNTATVHAVQTLRETLPLPIIGVEPGLKPAAAASRSKVVGVLAT
ANTLKGAKFARLLASLDGESRFLCTAGIGLVDAIERGDVGSAAVRASLAGFLQPMLDAGA
DTLVLGCTHYPFLTDTLVEMIGGRMALIDTGAAVARQLARRLAEHGIAAAPGAAPFTRYA
TTKEASHLQDMVAALLHVDAQAETIVIEPAPPLDAAAHVLR
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
gtgaaccagcccgccaacgacgctcccatcggcatcttcgattccggcctcggcggcctg
tcggtcctgcgcgagatccgcgcgctgctgccgcacgaatcgctgctgtatatcgccgat
tcgaagtacgccccctatggcgagaagccggagcgcttcgtcgaggcgcgcacgctgcag
gtctgccgctggctggccgaccaaggctgcaaggcgctggtgatcgcctgcaataccgcc
accgtccatgccgtgcagacgctgcgcgagacgctgccgctacccatcatcggggtagag
cccggcctgaagccggccgccgccgccagccgcagcaaggtggtgggcgtgctcgccacg
gccaatacgctcaagggcgcgaagttcgcgcgcctgctggcttcgctcgacggcgagagc
cgcttcctctgcaccgccggcatcggcctggtggacgcaatcgagcgcggcgacgtcggc
agcgcggcggtgcgcgccagcctggccggcttcctgcagcccatgctggacgccggcgcc
gacacgctggtactgggctgcacccactaccccttcctgacggacacgctggtggagatg
atcggcggacgcatggcgctgatcgataccggcgccgcggtcgcgcgtcagctcgcgcgc
cggctggccgagcacggcatcgccgccgcgcccggcgcggcccccttcacgcgctatgca
acgaccaaggaagccagccacctgcaggatatggtcgccgccctgctgcacgtcgacgcg
caggcggaaacgatcgtcatcgaaccggcgccgccgctggacgcggcggcacatgtcctg
cgctga

DBGET integrated database retrieval system