KEGG   Cupriavidus sp. USMAA2-4: BKK79_22785Help
Entry
BKK79_22785       CDS       T05072                                 

Definition
(GenBank) CDP-glucose 4,6-dehydratase
  KO
K01709  CDP-glucose 4,6-dehydratase [EC:4.2.1.45]
Organism
cuu  Cupriavidus sp. USMAA2-4
Pathway
cuu00520  Amino sugar and nucleotide sugar metabolism
cuu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cuu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BKK79_22785
Enzymes [BR:cuu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.45  CDP-glucose 4,6-dehydratase
     BKK79_22785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase Polysacc_synt_2 RmlD_sub_bind NAD_binding_4 3Beta_HSD
Motif
Other DBs
NCBI-ProteinID: AOY97004
UniProt: A0A1D9HB34
Position
2:complement(606511..607602)
Genome map
AA seq 363 aa AA seqDB search
MEGLAVKQFGDIFAGRRVLLTGHTGFKGSWLALWLTRLGASVTGYALAPTGERNHWRQLD
LPVAHREGDLRDLAGLDAAFAASRPEIVFHLAAQPLVRQSYREPLDTWSVNLMGTANLLE
LCRRHPQVRAVVVVTTDKVYHNREWAWGYRESDTLGGIDPYAASKAAAELAAQSYRQAFL
EARGILLATARAGNVIGGGDWSEDRLLPDLVRAQAAGQPLQVRSPRATRPWQHVLDCLSG
YLLLGQRLLAGDASCARAWNFGPAADDNRSVGAVLERMRAFWPELGWVDADTAGPHEAAL
LGLDSAEARKLLGWAPVWRLDDALRATAQWYRQALQGGAGLTHAQLADYIDCAAGAGAVW
TSA
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
gtggaaggtctggcagtgaagcagttcggcgatatcttcgcgggacggcgtgtcctgctg
accgggcataccggcttcaagggcagctggctggcgctgtggctgacccgcctcggcgcc
agcgtgaccggctatgcgctggcgcccacgggcgagcgcaaccactggcggcagctcgat
cttcccgtggcgcaccgcgagggcgatctgcgcgacctcgccggcctggacgctgccttt
gccgcgagccgtcccgagatcgtcttccacctggccgcccagccgctggtgcggcagtcc
taccgcgagccgctcgacacctggtccgtcaacctgatggggaccgccaacctgctcgaa
ctgtgccggcggcacccgcaggtgcgcgcggtggtggtggtcaccaccgacaaggtctat
cacaaccgcgaatgggcctggggctaccgcgagagcgacacgctcggcggcatcgacccc
tacgcggcctccaaggcggccgccgaactggcggcacagagctaccggcaggctttcctc
gaggcgcgcggcatcctgctggcgaccgcccgcgcgggcaacgtgatcggcggcggggac
tggtcggaagatcgcctgctgccggacctggtgcgcgcgcaggcggccgggcagccgctg
caggtacgctcgccgcgcgccacgcgcccctggcagcatgtgctggactgcctgtccggc
tacctgctgctcgggcagcgcttgctggcgggcgacgcgtcctgcgcgcgggcctggaac
ttcggcccggcggccgacgacaaccgcagcgtcggcgcggtgctggaacgcatgcgggca
ttctggcccgagctcggctgggtcgatgccgacaccgccggtccgcacgaggccgcgctg
ctcggcctggacagcgccgaggcgcgcaagctgctgggctgggcgccggtgtggcgactg
gacgatgcactgcgcgccaccgcccagtggtaccgccaggcgctgcagggcggcgccgga
ctgacgcatgcccagctggccgactacattgactgcgccgccggcgccggagcggtatgg
acaagcgcctga

DBGET integrated database retrieval system