KEGG   Cupriavidus sp. USMAA2-4: BKK79_24055Help
Entry
BKK79_24055       CDS       T05072                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
cuu  Cupriavidus sp. USMAA2-4
Pathway
cuu00473  D-Alanine metabolism
cuu01100  Metabolic pathways
cuu01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cuu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BKK79_24055
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    BKK79_24055
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cuu01011]
    BKK79_24055
Enzymes [BR:cuu01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     BKK79_24055
Peptidoglycan biosynthesis and degradation proteins [BR:cuu01011]
 Precursor biosynthesis
  Racemase
   BKK79_24055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AOY94933
UniProt: A0A1D9H4X9
Position
2:886710..887855
Genome map
AA seq 381 aa AA seqDB search
MPRPITATIHLPALASNLAAARRAAPASRVWAVVKADAYGHGIERAYPALRAADGFALLE
PAEAARLRALGWNKPILLLEGFFDAADVDRLGELGLSTTVHDEAQLRLLEDASRARRLAP
RSLDVCLKLNTGMNRLGFDPAGYGAAWRRLQAIEAVRSVTHMTHFSDADGDKGIAAQMAV
FHAATHGLPGAACVANSAGTLWHAGSRMDWVRAGIMLYGASPAGRWEDVAAQGLQPAMTL
SSRILAVRDVPAGEAVGYGSHYVAPARRRIGVVACGYADGYPRTASSHAGHFAPVWVDGV
ESRTVGRVSMDMLAVDLSDCPAAGVGTPVELWGRHVPIDRVAAAAGTLGYELMCAVAPRV
PVMVEALPAPAEENAGMALAG
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgcccgatcaccgccaccatccacctccccgccctcgcctccaacctcgctgcc
gcccgccgcgcggcgcccgcctcgcgcgtctgggcggtggtcaaggccgacgcctacggg
cacggcatcgagcgcgcctatccggcgctgcgcgcggccgacggcttcgccctgctcgaa
cccgccgaggcggcgcggctgcgcgcgctgggctggaacaaacccatcctgctgctggaa
ggcttcttcgacgccgccgacgtggaccggctgggcgagctcggcctgagcacgacggtg
catgacgaggcccagttgcgcctgctggaggacgcttcgcgcgcgcgccgccttgccccg
cgctcgctcgacgtctgcctgaagctgaacaccggcatgaaccgcctgggcttcgacccg
gccggctacggtgccgcctggcggcgcctgcaggccatcgaggcggtgcgctcggtcacg
cacatgacccacttctcggacgccgacggcgacaagggcatcgccgcgcagatggcggtc
ttccacgcggccacgcacgggctgccgggcgccgcctgcgtggcgaactcggccggcacg
ctgtggcatgccggcagccgcatggactgggtgcgggccggcatcatgctctacggcgcc
tcgcccgccgggcgctgggaggacgtggccgcgcagggcctgcagcccgccatgaccctg
agcagccgcatcctggccgtgcgcgacgtgccggccggcgaggcggtcggctacggctcg
cactacgtcgcgcccgcgcggcgccgcatcggcgtggtggcctgcggctatgccgacggc
tacccgcgcacggcgtcctcgcacgccgggcacttcgccccggtatgggtcgacggggtc
gagagccgcacggtcgggcgcgtctccatggacatgctcgcggtcgacctgagcgactgc
ccggcggccggcgtcggcacgccggtggaactgtggggacggcacgtgccgatcgaccgc
gtggcggcggccgccggcacgctcggctacgagttgatgtgcgcggtcgccccgcgcgtg
ccggtgatggtggaagccctgccggcaccggccgaagagaacgccgggatggccctggcc
ggctga

DBGET integrated database retrieval system