KEGG   Corynebacterium ureicelerivorans: CUREI_02130Help
Entry
CUREI_02130       CDS       T03241                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
cuv  Corynebacterium ureicelerivorans
Pathway
cuv00020  Citrate cycle (TCA cycle)
cuv00480  Glutathione metabolism
cuv01100  Metabolic pathways
cuv01110  Biosynthesis of secondary metabolites
cuv01120  Microbial metabolism in diverse environments
cuv01200  Carbon metabolism
cuv01210  2-Oxocarboxylic acid metabolism
cuv01230  Biosynthesis of amino acids
Module
cuv_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:cuv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CUREI_02130
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CUREI_02130
Enzymes [BR:cuv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     CUREI_02130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH
Motif
Other DBs
NCBI-ProteinID: AIL96267
UniProt: A0A077HNN0
Position
complement(403041..405224)
Genome map
AA seq 727 aa AA seqDB search
MAKIIWTRTDEAPLLATYSLKPIVEAFASRAGIDVDTADISLAGRILAQFPDRLGDKKVD
DALAQLGELAKTPEANIIKLPNISASLVQLKKAIAELQAAGFDIPDYEDAQEKYDAVKGS
AVNPVLREGNSDRRAPEAVKNYTKKHPHSMGEWSSDSKTNVATMDAGDFRHNEQSVIMPD
ADTLTIKLVTADGEQVLKDGLKVEAGEVIDGTYMSARALDAFLLDAVQRAKDEGVLFSAH
LKATMMKVSDPIIFGHVVRAYFKDIYDKYGDELLAAGLDGENGLGAIYDGLASLENGEEI
RAAFDKAMQDGPALAQVNSAKGITNLHVPSDVIIDASMPAMIRTSGHMWNADDQEQDTLA
VIPDSSYAGVYQTVIDDCRANGAYDPTTMGTVPNVGLMAKKAEEYGSHDKTFKIPADGKV
QVVNSAGDVLIEHDVEAGDIWRACQTKDAPIQDWVKLAVNRARLSGMKTIFWLDEERAHD
RNLIELVQKYLADHDTEGLDISIASPVEATRESVERIRRGEDTISVTGNVLRDYNTDLFP
ILELGTSAKMLSVVPLMAGGGLFETGAGGSAPKHVQQVEAENHLRWDSLGEYLALAESFR
HEKNTNGNDKAGVLADALDAATEKLLDEGKSPSRKVGEIDDRGSHFWLSLYWAEALAAQS
DDAELASVFGPIAEELRANADAIDKELLDAQGNAADLGGYYWPDEEKTSAVMRPSATFNK
IIDELEK
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagatcatttggacccgcaccgacgaagcgccgctgttggcgacgtactccctg
aagccgatcgtggaggcgttcgcgtcccgcgccggcatcgacgtggataccgccgacatt
tcgctggctggccgcatcttggcgcagttcccggatcgccttggcgacaagaaggtcgac
gacgcgctcgctcagctcggtgagctggcgaagacgccggaggccaacatcatcaagctg
ccgaacatctccgcttccctggtgcagctgaagaaggccatcgccgagctgcaggccgca
ggcttcgacatcccggactacgaggacgcgcaggagaagtacgacgcagtgaagggctcc
gctgtgaacccggtgctgcgcgagggcaactccgaccgccgcgctccggaggccgtgaag
aactacaccaaaaagcacccgcactccatgggcgagtggtcctccgactcgaagaccaac
gtggccaccatggacgccggcgacttccgccacaacgagcagtccgtgatcatgccggac
gccgacaccctgaccatcaagctcgtcaccgcagacggcgagcaggtgctcaaggacggc
ctgaaggtggaggccggcgaggtcatcgacggcacctacatgtccgctcgcgcgttggac
gccttcctgctcgacgccgtgcagcgcgccaaggacgagggcgtgctcttctccgcgcac
ctgaaggccaccatgatgaaggtctccgacccgatcatcttcggccacgtcgtgcgcgcc
tacttcaaggacatctacgacaagtacggcgacgagctgctggcagcaggcctggatggc
gagaacggcctgggcgcgatttacgacggcctggcttcgctggagaacggcgaggagatc
cgcgccgcattcgacaaggccatgcaagacggcccggcactggcgcaggtgaactccgcc
aagggcatcaccaacctgcacgtgccgtccgacgtgatcatcgacgcctccatgccggcg
atgatccgcacctccggccacatgtggaacgccgacgatcaggagcaggacaccctcgcg
gtcatcccggactcctcctacgccggcgtgtaccagaccgtgatcgatgactgccgtgcc
aacggcgcctacgacccgaccaccatgggcaccgtcccgaacgtgggcctgatggccaag
aaggccgaggagtacggctcccacgacaagaccttcaagatcccggccgacggcaaggtc
caggttgtgaactccgccggcgacgtgctgatcgagcacgacgtcgaggccggcgacatc
tggcgcgcatgccagaccaaggacgccccgatccaggactgggtcaagctggccgtcaac
cgcgcacgcctgtccggcatgaagaccatcttctggctggatgaggagcgcgcccacgac
cgcaacctgatcgagttggtgcagaagtacctggccgaccacgacaccgagggcctggac
atctccatcgcctccccggtcgaggccacccgcgagtcggtggagcgcatccgccgcggc
gaggacaccatctccgtcaccggcaacgtgctgcgcgactacaacaccgacctgttcccg
atcctggagctgggcacctccgcgaagatgctctccgtggtgccgctgatggctggcggc
ggcctgttcgagaccggtgccggcggctccgccccgaagcacgtccagcaggttgaggcg
gaaaaccacctgcgctgggattccctcggcgagtacctcgcgctggccgagtccttccgc
cacgagaagaacaccaacggcaacgacaaggctggcgtgctcgccgacgccttggatgcc
gccaccgagaaacttctcgacgaaggcaagtccccgtcccgcaaggtcggcgaaatcgac
gaccgcggctcccacttctggctctccctgtactgggccgaggcactggcggcccagtcc
gacgacgccgagctggcctccgtgttcggcccgattgccgaggagctgcgcgccaacgcc
gatgcgattgacaaggagctcctggacgcccagggcaacgctgccgacctcggcggctac
tactggccggacgaggaaaagacctccgcggtcatgcgcccgtccgcaaccttcaacaag
atcatcgacgaactggagaagtag

DBGET integrated database retrieval system