KEGG   Corynebacterium ureicelerivorans: CUREI_03295Help
Entry
CUREI_03295       CDS       T03241                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cuv  Corynebacterium ureicelerivorans
Pathway
cuv00071  Fatty acid degradation
cuv00072  Synthesis and degradation of ketone bodies
cuv00280  Valine, leucine and isoleucine degradation
cuv00310  Lysine degradation
cuv00380  Tryptophan metabolism
cuv00620  Pyruvate metabolism
cuv00630  Glyoxylate and dicarboxylate metabolism
cuv00640  Propanoate metabolism
cuv00650  Butanoate metabolism
cuv00900  Terpenoid backbone biosynthesis
cuv01100  Metabolic pathways
cuv01110  Biosynthesis of secondary metabolites
cuv01120  Microbial metabolism in diverse environments
cuv01130  Biosynthesis of antibiotics
cuv01200  Carbon metabolism
cuv01212  Fatty acid metabolism
cuv02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cuv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CUREI_03295
   00630 Glyoxylate and dicarboxylate metabolism
    CUREI_03295
   00640 Propanoate metabolism
    CUREI_03295
   00650 Butanoate metabolism
    CUREI_03295
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CUREI_03295
   00072 Synthesis and degradation of ketone bodies
    CUREI_03295
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CUREI_03295
   00310 Lysine degradation
    CUREI_03295
   00380 Tryptophan metabolism
    CUREI_03295
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CUREI_03295
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CUREI_03295
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CUREI_03295
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cuv04147]
    CUREI_03295
Enzymes [BR:cuv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CUREI_03295
Exosome [BR:cuv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CUREI_03295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AIL96449
UniProt: A0A077HJW2
Position
616778..617998
Genome map
AA seq 406 aa AA seqDB search
MSDPNDIVICNPKRTAVGRYGGAFVGVPVQELAATVVKAVIEDAGISGDAIDDIILGQAS
PNGAAPALGRVVALDAELGVDVPGMQLDRRCGSGLQAIATAAAHVAAGAADLIVAGGAES
MSNTEYTVDGKIRWGAKGGTMGLKDRLQEGREQAGGKHHPIPGGMIETAENLREEYSIAR
ERQDKLALASHARAAAAQEAGDFDAEIVPVSVPQRKGDPVVVDKDEHIRPGTSEESLANL
RPVMGKTLEAATVTAGNASGQNDGAAAMIVTTRAKAEELGLDLYAVLRGWAVAGVAPETM
GIGPVDATKKVFDRLGLTFDDIDLIELNEAFAAQALAVLDAWGIAEDDPRVNPVGSGISL
GHPVGATGARMVVTAAHQMRRTDAQRALVTMCIGGGQGLAAVIEKA
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacccgaacgatattgtcatctgcaaccccaagcgcaccgcagtcgggcgctac
ggcggcgcattcgtcggcgtgccggtgcaggagctggccgcgaccgtggtcaaggccgtg
atcgaggatgccgggatctccggcgacgcgatcgacgacatcatcctcggccaggcctcg
ccgaacggcgccgcacccgcgctaggccgcgttgtcgcactcgacgctgagctgggcgtt
gacgtgcccggcatgcagctggaccgccgctgcggctccggcttgcaggcgatcgccact
gccgcggcgcacgtggctgccggtgccgccgacctgatcgtcgcgggcggtgcggaatcc
atgtccaacaccgagtacaccgtggacggaaagatccgctggggtgcaaagggcggcacg
atggggctcaaggaccgcctgcaggagggccgcgagcaggcgggcggcaagcaccacccg
atcccgggcggaatgatcgagactgcggagaacctgcgcgaggagtactcgatcgcgcgc
gaacgtcaggacaagctggcgttggcgtcgcacgcccgcgccgcggcggcgcaggaggct
ggagacttcgacgccgagatcgtgccggtttcggtgccgcagcgcaaaggtgatccggtg
gtggtggacaaggacgagcacatccgccccggaacctccgaggagtcgctggccaatctg
cggccggtgatgggcaaaacgctggaggcggccacggtgactgccggcaacgcctctggc
cagaacgacggcgccgccgcgatgatcgtgaccacccgtgccaaggccgaggagctgggc
ctggacctctacgctgtcctgcgcggctgggccgtcgctggcgtcgcgccggagaccatg
ggcatcgggcctgtcgacgccacgaagaaggtgttcgaccgcctcggcctgaccttcgac
gacatcgacctgattgaactgaacgaggcctttgccgcccaggcactcgcagtgctcgat
gcgtgggggatcgccgaggacgacccacgcgtgaacccggtgggctccggaatctcgctg
ggccacccggtgggtgccaccggcgcgcgcatggtggtcactgccgcgcatcagatgcgc
cgcaccgacgcccagcgtgcgctcgtgaccatgtgcatcggcggtggtcaggggcttgct
gcggtgattgagaaggcttaa

DBGET integrated database retrieval system