KEGG   Corynebacterium ureicelerivorans: CUREI_06160Help
Entry
CUREI_06160       CDS       T03241                                 

Definition
(GenBank) formate--tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
cuv  Corynebacterium ureicelerivorans
Pathway
cuv00670  One carbon pool by folate
cuv01100  Metabolic pathways
cuv01120  Microbial metabolism in diverse environments
cuv01200  Carbon metabolism
Module
cuv_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:cuv00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    CUREI_06160
Enzymes [BR:cuv01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     CUREI_06160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS
Motif
Other DBs
NCBI-ProteinID: AIL96931
UniProt: A0A077HKF7
Position
complement(1200713..1202380)
Genome map
AA seq 555 aa AA seqDB search
MTAQPLTDVEIAQAHELAPIADIAAQAGVGEDALIPYGKHMAKVDITQVPSGNLGKLVVV
TGVSPTPAGEGKSTTLIGLTDALAKLGQNAMVALREPSLGPVMGIKGGAAGGGYSQVVPM
EQINLHFTGDFHAITSANNMLAALIDNHIHQGNALGIDPRRVTWQRCLDVNDRALRNVVT
GLGGPAHGVPAETGFTITAASEIMAILGLATDLEDLKQRLANITIGLTYDKKPVTAGDLG
AEGAMAALLKDAVNPNLVQTLGGTPAFIHGGPFANIAHGCNTLIATRTAQQYADIVLTEA
GFGSDLGAEKFFDIKARYGGLDVAGAVIVATIRSIKHNAGVAKAELSNENVAALEEGIVN
LERHVENVRKFGVTPVVELNRFTSDTSAELEFVHAWAKDKGVALAEADVWGKGGDGALEL
AQTLLDNLTEGTSRPLYDPAEGVERSIETIAKEIYRADNVQYSAAALKDLQTLKDNGFDN
LPVCISKTQYSFSDDPSKLGAPTGHTLHVRNLIPRTGAGFVLVLTGDVMTMPGLPKKPAA
NNIDVDNNGVISGLF
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgactgctcaaccgttgactgacgtcgaaatcgcccaagcccacgagctcgctcccatc
gccgacattgccgcacaggccggggtcggcgaggatgcgctcatcccgtacggcaagcac
atggccaaggtggacatcacccaggtgccgtccggcaacctcggcaagctggtcgttgtg
accggcgtgtcgccgacacctgccggcgaaggtaaatccaccacgcttatcggcctgacc
gacgcgttggcgaagttggggcaaaacgcgatggtggcgctgcgcgagccctcgctcggc
ccggtgatgggcatcaagggcggcgcggctggcggcggttactcccaggtggtgccgatg
gagcagatcaacctccacttcaccggtgatttccacgccatcaccagcgccaacaacatg
ctcgcggccttgattgacaaccacattcaccagggcaacgcgctgggcatcgacccgcgc
cgggtgacctggcagcgctgcctggatgtcaacgaccgcgcgttgcgcaacgtggtcacg
ggccttggtgggccagcacacggcgtgccggcggaaaccgggttcaccattaccgctgcg
tcggaaatcatggcgatcctcggcctggcaacggacctagaggaccttaagcagcgcctg
gccaacatcaccatcggcctgacctacgacaagaagccggtcactgcgggcgacctcggg
gctgaaggcgcgatggcggcgctgctgaaggacgctgtgaacccaaacctggtgcaaacc
ttgggcgggactccagcgttcatccacggcggccccttcgccaacatcgcccacggctgc
aacaccctgattgccacccgcaccgcgcagcagtacgccgacatcgtgctcacagaggcc
gggttcggctcggacctcggcgcggagaaattcttcgacatcaaggcgcgctacggcggc
ctggatgttgcaggcgcagtcatcgtcgccaccatccgttccatcaaacacaacgcaggt
gtggccaaggcagaactgtccaatgagaacgtcgctgcgctggaggaaggcattgtcaac
cttgagcgccacgtggagaacgtgcgcaagttcggtgtcaccccggtggtggagctgaac
cggtttacttccgatacgtccgccgagctggagttcgtgcacgcatgggcgaaagacaag
ggcgttgcgctggcggaagcggatgtgtggggcaagggcggcgacggcgcgctggagctc
gcccagacgctgctggacaacctcaccgagggcacctcgcgcccgctctacgacccggcc
gagggcgtcgagcgctccatcgagaccattgccaaagagatctaccgcgcggacaacgtc
cagtactccgctgctgcgctgaaggatttgcagacgctcaaagacaacggctttgacaac
ctcccggtctgcatctccaagacgcagtactccttctcggacgacccgtcgaagctgggc
gcaccgaccgggcacaccctgcacgtgcggaacctcatcccgcgcaccggcgcaggcttc
gtgcttgtgctcacgggcgatgtgatgactatgccgggcctgcccaagaagccggcggcg
aacaacatcgacgtggacaacaacggcgtgatcagcggcctgttctag

DBGET integrated database retrieval system