KEGG   Corynebacterium ureicelerivorans: CUREI_09450Help
Entry
CUREI_09450       CDS       T03241                                 

Definition
(GenBank) pyruvate decarboxylase
  KO
K01568  pyruvate decarboxylase [EC:4.1.1.1]
Organism
cuv  Corynebacterium ureicelerivorans
Pathway
cuv00010  Glycolysis / Gluconeogenesis
cuv01100  Metabolic pathways
cuv01110  Biosynthesis of secondary metabolites
cuv01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cuv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CUREI_09450
Enzymes [BR:cuv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.1  pyruvate decarboxylase
     CUREI_09450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_N TPP_enzyme_M TPP_enzyme_C E1-N
Motif
Other DBs
NCBI-ProteinID: AIL97470
UniProt: A0A077HME3
Position
complement(1863989..1865692)
Genome map
AA seq 567 aa AA seqDB search
MATTVGHYLATRLEQIGLEHYFQVPGDYNLQLLDELLKNENLQMMSCTNELNAAYAAEGY
ARANGASACVITFNVGAFSALNGVAGAYAERLPMIFISAGYNTNDEASGRFLHHTIGTTD
YSYQEEMFRPVTCKTVRILTAEEAPAKIDDAIATALRESKPCYIEIASNLADAECPAPQP
ARFERAWEVGYDHKAVEKAATEIAAQLNAAEKPLLLAGPHLRPYGAVEAFRRVAEAIGCA
VAVQPNAKSFFPEDHPQYIGHYLGTSSAPGVEAVVDLADCVLAAGPMFTDYSTVGWTTTV
PSESGYIAIAENGVTTPEATYTGLPIAAVLEALAGKVERNTATIDQYNRDDVTGQQAEYT
PADDSAQLTRAEMVHQINELIDGNSTLFAETGDSWFNGLHMQLPADAGFEIEMQWGAIGW
SVPSSHGYAVAKGQDHHTILMVGDGSFQLTAQEVCNMIRYEDNITVIVVNNTGYVIESAL
HEGPYNYYKNWDYAALIKAFNAEDGEGIGITATTAGELRDALRVARASTRRPVLIEAQIP
HDDMTQDLVKWGKPVSAAIGRPPATQQ
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atggcaactactgtcggccactacctggccacccgcttggagcagatcggcttggagcac
tacttccaggtcccgggcgactacaacctgcagcttttggacgaactgctcaaaaacgag
aatctgcagatgatgagctgcaccaacgaactcaacgccgcctatgcggccgagggctac
gcccgcgcgaacggcgcatcggcatgcgtgatcaccttcaacgtcggtgcgttctccgcg
ctgaacggtgtcgccggcgcctacgcggagcgcctgcccatgatcttcatctccgcaggc
tacaacaccaacgacgaggcttcggggcggttcctgcaccacaccatcggcaccacggac
tactcctaccaggaggaaatgttccgcccggtgacctgcaagacggtgcgcatcctcacc
gcggaggaggccccggcaaagatcgacgacgccatcgccaccgccctgcgcgagtccaag
ccctgctacatcgaaatcgcgtccaatctggcggacgccgaatgccctgctccccagccg
gcgcggtttgagcgggcgtgggaggtcggttacgaccacaaggcagtggagaaggccgcc
acggagatcgcggcccagctcaacgctgcggagaagccgctcctgctggccggaccgcat
ctgcgcccgtacggtgccgtcgaggcgtttcggcgggtggcggaggcaatcggatgcgcc
gtggctgtgcagccgaacgcgaagagcttcttccccgaagaccacccgcagtacatcggg
cactacttgggcacatcgtccgcgccgggcgttgaggccgtggtggacctcgctgactgc
gtgctcgcggcgggcccgatgttcaccgactactccacggtggggtggaccaccaccgtg
ccgtcggagagcggctatatcgcgatcgccgaaaacggtgtgaccacgcccgaggccacg
tacaccggcctgcccatcgcggcggtgcttgaggcgctcgccggcaaggtggagcgcaac
accgcaacgatcgaccagtacaaccgcgacgacgtcaccgggcagcaggccgaatacacc
cctgccgatgactcggcgcagctcacccgtgctgagatggtgcaccagatcaacgagttg
atcgacggcaactccaccctgttcgccgagaccggcgactcctggttcaacggcctgcac
atgcagctgcccgccgacgccggttttgaaattgagatgcagtggggtgccatcggctgg
tccgtgccgtcctcgcacggctacgcagtggccaagggtcaggaccaccacaccatcctc
atggtcggcgacggttccttccagctcaccgcgcaagaggtgtgcaacatgatccgctac
gaggacaacatcaccgtcattgtggtgaacaacacgggctacgtcatcgagtctgctctc
cacgaggggccgtacaactactacaagaactgggactacgcggccctgatcaaggcgttc
aacgccgaggacggcgagggtatagggatcaccgccaccaccgcgggcgagcttcgcgac
gcgctccgcgtcgcacgcgcgagcacccgccgcccggtgctgatcgaggcccagatcccc
cacgacgacatgacccaggatctggtgaagtggggcaagccggtctccgccgcaatcggc
cgcccgcccgctacacagcagtaa

DBGET integrated database retrieval system