KEGG   Corynebacterium ulcerans 05146: Cul05146_0731Help
Entry
Cul05146_0731     CDS       T03420                                 

Gene name
folA
Definition
(GenBank) Dihydrofolate reductase
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
cuz  Corynebacterium ulcerans 05146
Pathway
cuz00670  One carbon pool by folate
cuz00790  Folate biosynthesis
cuz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cuz00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Cul05146_0731 (folA)
   00670 One carbon pool by folate
    Cul05146_0731 (folA)
Enzymes [BR:cuz01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Cul05146_0731 (folA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1
Motif
Other DBs
NCBI-ProteinID: AIU91311
Position
complement(735298..735825)
Genome map
AA seq 175 aa AA seqDB search
MLRAIWAQSCDGVIGNGVDMPWHLPEDLAHFKKTTLGCPVIMGRKTWESLPPAFRPLPGR
NNYVLSRSAAGQWSTGACVVSELPDVTDAWVMGGGQIYAATLPKVEEVVRTIVRIELLDV
LGDSAVSAPALGPEFEIVSETEWMTSISGKVHEDYQAATSPQPLHYKFQRLRRTP
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgggcaatttgggcgcagtcctgcgacggggtcatcggcaatggtgtggatatg
ccctggcatctgcccgaggatctcgctcattttaaaaaaaccacgcttggctgcccagtc
atcatgggacgcaagacatgggagtcgctgccgccagcctttcgcccactgcctgggcgc
aacaactacgtgctttcccgctccgcagctggtcagtggagcaccggtgcctgcgtagtg
agcgagttgcccgacgtcacagacgcgtgggtcatgggaggcggacaaatttatgcggca
accctgcctaaggtggaggaagtagtgcgcaccatcgtgcgcattgagcttctcgacgtc
ctcggcgactccgcggtttccgcccctgcgcttggccccgagtttgagatcgtatcggaa
actgagtggatgacgtcgataagcggaaaagtacacgaagactaccaagcagcaacttcc
ccacagccgctgcactacaaattccaaaggttgcgacgcactccctga

DBGET integrated database retrieval system