KEGG   Corynebacterium ulcerans 05146: Cul05146_1888Help
Entry
Cul05146_1888     CDS       T03420                                 

Gene name
cat
Definition
(GenBank) Succinyl-CoA Coenzyme A transferase
  KO
K18118  succinyl-CoA:acetate CoA-transferase [EC:2.8.3.18]
Organism
cuz  Corynebacterium ulcerans 05146
Pathway
cuz00020  Citrate cycle (TCA cycle)
cuz00620  Pyruvate metabolism
cuz00650  Butanoate metabolism
cuz01100  Metabolic pathways
cuz01110  Biosynthesis of secondary metabolites
cuz01120  Microbial metabolism in diverse environments
cuz01130  Biosynthesis of antibiotics
cuz01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cuz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Cul05146_1888 (cat)
   00620 Pyruvate metabolism
    Cul05146_1888 (cat)
   00650 Butanoate metabolism
    Cul05146_1888 (cat)
Enzymes [BR:cuz01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.18  succinyl-CoA:acetate CoA-transferase
     Cul05146_1888 (cat)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetylCoA_hyd_C AcetylCoA_hydro CoA_trans
Motif
Other DBs
NCBI-ProteinID: AIU92431
Position
complement(1964531..1966036)
Genome map
AA seq 501 aa AA seqDB search
MSDRIANAQLRGKIMSAQEAAQFVDNGDKVGVSGFTGAGYPKVMPAAIAERAKEARAKGE
SYTIDLFTGASTAPDCDGVLAEAGALRFRMPYQSDPSMRKAINSGDMLYSDIHLSHSGAM
VAEGFFGQLNVAIVEAVRIKEDGSIVPSSSVGNSVEYLDAAEKIIIEVNSWQSEHLEGMH
DIWRMPRTPNRIPIPIKNTGDRIGDTSISIDPNKVVAVIETDAPDRNAPFKPLDDVSREI
ASNFLGFLEGEVKAGRLDYDRYIMQSGVGNVPNAVMAGLLDSKFENIQAYTEVIQDGMVD
LIDAGKMTVASATSFSLSPEYADKMNENAEFYRKHIILRPQQISNHPEVIRRTGLIASNG
MIEADIYGNVNSTHVNGVRMMNGIGGSGDFTRNALISTFISPSVAKDGAISAIVPFVSHT
DHTEHDVMVIITEYGVADLRGLAPRERVQKTISVAHPDYRPLLEEYFEAAKKATPFMQTP
HDLTQAFSFHQRMNETGTMAK
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgtctgatcgcattgctaacgcacagttgcggggcaaaattatgtcggcacaagaggcc
gctcagttcgtagacaacggcgataaagtcggtgtttcgggctttaccggtgctggctac
ccaaaggttatgcctgctgcaatcgctgaacgggcaaaggaagcgcgggctaaaggggaa
agctacaccattgatctctttaccggagcttctaccgcaccagactgcgatggcgtacta
gcagaagccggagctttgcgtttccgaatgccgtatcagtcagaccccagcatgcgtaaa
gctattaactcaggcgacatgctgtactccgatattcacctgtcgcattcaggcgcaatg
gtcgcggagggcttctttggccagctgaacgtggccatcgttgaggctgtccgcattaag
gaagatggatcgatcgtgccttcttcctccgtaggaaactctgtggaataccttgatgct
gcagaaaaaatcatcatcgaggttaactcctggcagtccgagcaccttgaaggaatgcac
gacatttggagaatgccgcgtaccccgaaccgcattcctatcccgatcaagaacaccggt
gaccgtatcggcgatacctcgatttctatcgaccccaataaggtagtcgcggttattgag
accgatgctcctgaccgcaacgctcctttcaagcctctcgacgacgtctctcgcgagatc
gcctcgaacttcttgggcttcctcgaaggcgaagtgaaagctggccgcctcgattatgac
cgctacatcatgcagtccggtgtgggtaacgttcccaatgccgtgatggcaggcctgttg
gactctaagtttgaaaacattcaggcttacaccgaggttatccaagatggcatggtcgac
ctgatcgacgccggcaagatgaccgttgcctctgcgacctcattctcgctgtcgccggag
tacgcagacaagatgaacgagaatgcggagttctaccgcaaacacatcattcttcgccca
cagcagatctctaaccaccctgaggtgatccgccgcaccggactgatcgcatccaacggc
atgatcgaagctgacatttacggcaacgtgaattcaacgcacgtcaatggtgtgcgcatg
atgaacggtattggtggctccggtgacttcactcgtaacgctttgatctccacgttcatc
tctccatcggtggctaaggacggtgctatctccgctatcgttcctttcgtatctcacacc
gaccacacggagcacgacgtcatggtgattatcaccgagtatggtgtcgcagacttgcgt
ggacttgcgccacgcgagagagtccaaaagaccatttccgttgcgcatccggattatcgt
cccttgctggaggagtacttcgaggcagcaaagaaggcaacgcctttcatgcagacccct
catgaccttacccaggcattctcgttccaccagcgcatgaacgagaccggaaccatggct
aagtaa

DBGET integrated database retrieval system