KEGG   Corynebacterium variabile: CVAR_0938Help
Entry
CVAR_0938         CDS       T01594                                 

Gene name
phdC
Definition
(GenBank) pyruvate dehydrogenase complex E2 component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
cva  Corynebacterium variabile
Pathway
cva00010  Glycolysis / Gluconeogenesis
cva00020  Citrate cycle (TCA cycle)
cva00620  Pyruvate metabolism
cva01100  Metabolic pathways
cva01110  Biosynthesis of secondary metabolites
cva01120  Microbial metabolism in diverse environments
cva01130  Biosynthesis of antibiotics
cva01200  Carbon metabolism
Module
cva_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cva00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CVAR_0938 (phdC)
   00020 Citrate cycle (TCA cycle)
    CVAR_0938 (phdC)
   00620 Pyruvate metabolism
    CVAR_0938 (phdC)
Enzymes [BR:cva01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     CVAR_0938 (phdC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H NQRA RnfC_N
Motif
Other DBs
NCBI-ProteinID: AEK36291
UniProt: G0HD14
Position
1065925..1067334
Genome map
AA seq 469 aa AA seqDB search
MAYSFIMPELGEGLAEGTISNWLVAEGDTVEEDQDLVEIENDKAVTELPSPVEGTVEKIN
FGPGDVAKVGDVLIVIDDGSPDTGADAVEDASHPAVIADATAHEEHSAKGGADEAVTAQE
NPVNRQTRPAAPTEPGTTPTEVAPLRNDGDPAVAAAEGTRVLAMPAVRRYARERDVDITT
VIPTGAHGHVTRGDIDKAYGAPKAADTEAATENAPAQDAAASSPVAAAPAPVRPTEGDRR
EAYAGISAATGRAMSASHATIPPVTNFGEVEVSALLKLQKKYKEHAAEQDVHLTILPFIV
KALVAAMKKYPVLNGALDTETNEIVYHAACNVAIATDTPRGLYAPVVKDADRVNVLEIAK
TIGDNAGKAAEGKLSADDMSGAGVTVSNLGGVDGGWFTPIISVGQSAILGVGRAVKAPYV
NDDGELAVGRMMKLSLTYDHRIIDGVRGQEILNTVMRLLHDPNLLVIEG
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atggcttattcattcatcatgccggagctgggcgagggcctggccgagggaaccatctcc
aactggctggtcgccgagggtgacacggtcgaggaggatcaggacctcgtcgagatcgag
aacgacaaggcggtcaccgaactgccctcgccggtcgagggcaccgtcgagaagatcaac
ttcggacccggtgacgtcgccaaggtcggtgacgttctcatcgtcatcgacgacgggtcg
ccggataccggggccgatgccgtcgaggacgcctctcacccggccgttatcgccgacgcc
accgcccacgaggagcactccgccaagggcggcgccgatgaggcggtgacggcacaggag
aacccggtcaaccggcagacccgaccggccgcccccaccgaaccgggcacgacacccacc
gaggtcgcgccgctgcgcaacgacggtgacccggctgtcgccgcggccgaggggacccgc
gtcctcgcgatgccggcggtgcgccgttacgcccgcgagcgtgacgtggacatcaccacg
gtcatcccgaccggagcccacggccacgtcacccgcggtgacatcgacaaggcctacggt
gcgccgaaggccgccgacaccgaggcagccacagagaacgctcccgcgcaggacgccgcg
gcgtcctccccggtcgctgccgcacccgcgccggtgcgtccgaccgaaggtgaccgtcgc
gaggcctacgccggcatctcggcggccaccggccgggcgatgtccgcctcccacgcgacg
atcccgccggtcaccaacttcggcgaggtcgaggtctccgcgctgctcaagctgcagaag
aagtacaaggagcacgctgccgagcaggacgtccacctgaccatcctgccgttcatcgtc
aaggcgctcgtcgccgcgatgaagaagtacccggtgctcaacggcgcgttggatacggag
accaacgagatcgtctaccacgcggcctgcaatgtcgcgatcgccaccgacaccccgcgc
gggctctacgccccggtggtcaaggacgccgaccgcgtcaatgtcctcgagatcgcgaag
accatcggcgacaacgccggcaaggcggccgagggcaagctgtccgcggacgacatgtcc
ggcgccggcgtcaccgtgagcaacctcggcggtgtcgacggtggctggttcaccccgatc
atcagtgtcgggcagtccgcaatcctcggtgtgggccgtgccgtcaaggcaccctacgtc
aacgacgacggtgagctggctgtcggcaggatgatgaagctctcgctgacctacgaccac
cgcatcatcgacggtgtgcgcggccaggagatcctcaacacggtcatgcggctgctgcac
gacccgaacctgctggtcatcgaaggttag

DBGET integrated database retrieval system