KEGG   Corynebacterium variabile: CVAR_1004Help
Entry
CVAR_1004         CDS       T01594                                 

Definition
(GenBank) hypothetical protein
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
cva  Corynebacterium variabile
Pathway
cva00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:cva00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    CVAR_1004
Enzymes [BR:cva01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     CVAR_1004
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     CVAR_1004
    1.1.1.-  
     CVAR_1004
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C DZR AdoHcyase_NAD FAD_binding_3 2-Hacid_dh_C Ntox34 Prok-RING_1
Motif
Other DBs
NCBI-ProteinID: AEK36358
UniProt: G0HD81
Position
1149446..1150537
Genome map
AA seq 363 aa AA seqDB search
MKAARYYGNHDIRIEDIDQQTLEPGTVRIDVAWCGICGTDLHEYLDGPIFCPTCETPHPI
SGETAPVTLGHEFSGVISEVGEGVTDLSVGDHVVVEPYIIRDDVDTSTDNDTYHLSEDMN
FIGLAGRGGGLSENIVVRRRWVHRIDNSLPLDEAALIEPLSVGYHAVKRSGITEENGAGK
VALIGGAGPIGLLTAAVLNAMGVTVVMSELSPLRRQKALDSGVAAHAFSPAETDIVDEVN
KLTDGKGADVAFECTSVQVVLDTLMDAVRPTGVIVVVSIWGHKSDFNMHKLVMKEIDLRG
TIGYVNSHPDTIKLVESGKIDLKPFITGKIGLDGLVDEGFGTLINRNETAVKILVSPSGE
GLE
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcagcacgctactacggcaatcacgacatccgcatcgaggacatcgaccagcag
accctggagcccggcaccgtccgcatcgacgtcgcctggtgcggcatctgcggtaccgac
ctgcacgagtacctcgacggcccgatcttctgcccgacctgcgagaccccgcacccgatc
tccggggagaccgccccggtcactctcggccacgagttctccggcgtcatctccgaggtc
ggcgagggcgtcaccgacctcagtgtcggcgaccacgtcgtcgtcgagccctacatcatc
cgcgatgacgtggacacctccaccgacaacgacacctaccatctctccgaggacatgaac
ttcatcggactggcaggacgcggcggcggactctcggagaacatcgtcgtgcgccgtcgc
tgggtgcacaggatcgacaactccctcccgctcgacgaggccgcactcatcgagccgctg
tccgtcggctaccacgccgtgaagcgctccggcatcaccgaggagaacggcgccggcaag
gtcgcgctgatcggtggcgccggtccgatcggcctgctcaccgccgccgtcctcaacgcc
atgggcgtcaccgtcgtcatgtccgagctgtccccgctgcgccgccagaaggccctggac
tccggcgtcgccgcccacgccttcagccccgccgagaccgatatcgtcgacgaggtcaac
aagctcaccgacggcaagggtgccgacgtcgccttcgagtgcacctccgtccaggtcgtc
ctcgacacgctgatggacgcggtgcgccccaccggcgtcatcgtcgtggtctccatctgg
ggccacaagtccgacttcaacatgcacaagctcgtcatgaaggagatcgacctgcgcggc
accatcggctacgtcaactcccacccggacaccatcaagctggtcgaatccgggaagatc
gacctcaagccgttcatcaccggcaagatcggcctcgacggcctggtcgacgagggcttc
ggcaccctcatcaaccgcaacgagaccgccgtgaagatcctcgtctccccgtccggtgag
gggctggagtaa

DBGET integrated database retrieval system