KEGG   Corynebacterium variabile: CVAR_1317Help
Entry
CVAR_1317         CDS       T01594                                 

Gene name
amiC
Definition
(GenBank) amidase
  KO
K01426  amidase [EC:3.5.1.4]
Organism
cva  Corynebacterium variabile
Pathway
cva00330  Arginine and proline metabolism
cva00360  Phenylalanine metabolism
cva00380  Tryptophan metabolism
cva00627  Aminobenzoate degradation
cva00643  Styrene degradation
cva01100  Metabolic pathways
cva01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cva00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    CVAR_1317 (amiC)
   00360 Phenylalanine metabolism
    CVAR_1317 (amiC)
   00380 Tryptophan metabolism
    CVAR_1317 (amiC)
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    CVAR_1317 (amiC)
   00643 Styrene degradation
    CVAR_1317 (amiC)
Enzymes [BR:cva01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.4  amidase
     CVAR_1317 (amiC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AEK36673
UniProt: G0HBF5
Position
1516479..1517918
Genome map
AA seq 479 aa AA seqDB search
MNTPEIPWHTLDAHDWRDHVATFTDDPEREPGSPGGAETGVRAALTRIARYDRDLNAFQT
VLADEALATATDLDRLEPAQRGRLHGVPVAVKAEIDVKGVVTTFGTRANTTPATADALVV
QKLRDAGAVIIGVTRMPEFGAWPYTQTDGYGVTRNPHDQSKTPGGSSGGSAAAVAAGLVP
VALGGDGGGSIRIPAANCGLFGLKPQRGRVSASPNPHLWHALGTTGPLTRSVRDSALVYD
LVSGNVDGDAYRAEPVGSLVEAVDGAAAAPRLRIGVCLTPPAKTGKLHPEHAAAVHRAAD
LLRAAGHTVTEYDPHYPDPTASFIPQFFAGIRTEKGGVEHPERLEARTRAVVRTGAWVRR
PVHRWAEKKGGTIARALDHAWTEVDVLLTPTVPDRPGAADAIAGKGAVRTLLAASGPVAY
TAMWNVTGFPAASVPLGTGSDGLPLSVQLVGPDNGEERLVALSSELETALDAGTADETT
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgaataccccggagattccctggcacaccttggacgcacacgactggcgcgatcacgtc
gccacgttcacggacgacccggaacgggaacccgggtcgccgggtggggcagagaccggc
gtacgtgccgccctgacgcgcatcgcccgctacgaccgggatctcaacgccttccagacc
gtcctcgccgatgaggctctcgctaccgcgaccgatctcgaccggctggaacccgctcag
cgtggccgactgcacggcgttccggtggcggtgaaagccgagatcgacgtcaagggcgtg
gtgaccaccttcggcacccgggcaaacaccactccggcgaccgcggacgccctcgtcgtg
cagaagctcagggacgccggcgcggtcatcataggggtgacgcgcatgcccgagttcggg
gcctggccctacacacagacggacggttacggtgtcacccgcaatccgcacgaccagtcg
aagacgcccggcggctcctcgggtggttcggcagccgcggtcgccgccggactggtcccc
gtcgccctcggcggtgacggtggcgggtcgatccgcattcccgcggcgaactgcggtctg
ttcggcctcaagccccagcgtggtcgggtttccgcgtccccgaacccccacctgtggcat
gcactcggcaccaccggcccgctcacccgttccgtgcgggacagtgctctggtctatgac
ctcgtcagcggaaacgtcgacggggacgcctaccgtgccgaacctgtcgggtcactggtc
gaggcggtcgacggtgccgctgcggcaccgcggttgcgcatcggtgtgtgcctcactccg
ccggcgaagaccgggaaactccaccccgagcatgcggcggcggtgcaccgtgccgctgat
ctgctgcgcgccgcagggcacacggtcacggagtacgacccgcactatccggaccccacc
gcgtccttcatcccccagttcttcgccggaatccgcacggagaaaggcggggtcgaacac
ccggagcgactggaggcacgcacccgggccgtggtccggacgggtgcctgggtccgccgc
ccggtccaccggtgggcggagaagaagggcgggacgatcgcccgcgccctggaccacgcc
tggacagaggtggatgtcctgctcaccccgacggtgcctgaccggccgggtgcggcggac
gcgatcgccggcaagggtgcggtgcggaccctgctcgcggccagcgggccggtggcctac
accgcgatgtggaacgtcaccgggttcccggcggcgtccgtcccgctgggcaccggcagc
gacggtctgccgctgtccgtgcagctcgtggggccggacaacggcgaggaacgcctcgtc
gcgctgtcctccgaactggagacggcactggatgccgggaccgccgacgagacgacctag

DBGET integrated database retrieval system