KEGG   Corynebacterium variabile: CVAR_1756Help
Entry
CVAR_1756         CDS       T01594                                 

Definition
(GenBank) hypothetical protein
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
cva  Corynebacterium variabile
Pathway
cva00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:cva00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    CVAR_1756
Enzymes [BR:cva01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     CVAR_1756
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     CVAR_1756
    1.1.1.-  
     CVAR_1756
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C PALP TrkA_N FAD_binding_3 Pyr_redox_3 F420_oxidored
Motif
Other DBs
NCBI-ProteinID: AEK37108
UniProt: G0HBJ5
Position
2019669..2020694
Genome map
AA seq 341 aa AA seqDB search
MYTTTVHGAHDVRFDDLTPVSPGTGEVRIRPAFNGICGSDIHLIENPETSGYVLRHDADG
NLAMPVGHEFSGTVEELGEGVTGVSVGDRVAVFPFAYCGECEACTRGMEECCERPTDLPG
GLSSSVTVPQRCVFPLPESVDLHLGALVEPMAVAWHAVRLAEVTPEDAVVIAGAGPIGLG
LFFALRAQGVEKVVISEPSTERREVAEALGAQVVDATASGFSAQVRALVGPGRPTVGFDA
AGPAPAFSAVLRLLGLRGRTVVVAIHTREFAFNPTMALLARERSILHTYAYSVADFREVI
EAMAQGHYPTDGWVEVRPASELLDAVEDLTAGEGSKILLEI
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgtacaccaccaccgtccacggtgcccacgacgtccgcttcgacgacctcaccccggtc
tccccgggcaccggcgaggtccgcatccggccagcgttcaacggcatctgcggctccgac
attcacctcatcgagaatccggagacctccggctacgtcctacgccacgacgccgacggc
aacctcgccatgcccgtcggccacgagttctccggcaccgtcgaggaactcggcgagggg
gtcaccggcgtttccgtcggcgaccgggtggcggtcttccccttcgcctactgcggggag
tgcgaggcctgcacccgtggcatggaggagtgctgtgagcggcccacggacctgcccggt
ggcctgagcagctcggtcaccgtcccgcagcgctgtgtcttcccgctgccggaatccgtg
gacctgcacctcggcgccctggtggaaccgatggcggtggcctggcacgcggtccgcctc
gccgaggtcaccccggaggatgccgtggtgatcgccggcgccggaccgatcggtctggga
ctgttcttcgcgctgcgggcgcagggagtggagaaggtcgtcatctccgaaccctcgacc
gagcgccgggaggtcgccgaagccctcggcgcacaggtggtggacgccaccgcgtccggc
ttctcggcgcaggtgcgggccctggtcggcccggggcgtccgaccgtcggcttcgacgcc
gccgggcccgcccccgccttcagcgctgtcctgcgactgctgggcctgcgcggccggacg
gtggtcgtggcgatccacacccgggagttcgccttcaacccgaccatggccctgctcgcc
cgcgaacgctcgatcctgcacacctacgcctactccgtggctgacttccgcgaggtcatc
gaggcgatggcccagggccactaccccaccgacgggtgggtggaggtccgcccggccagc
gagcttctggacgcagtggaggacctcaccgcaggggaaggctccaagatcctgctggag
atctga

DBGET integrated database retrieval system