KEGG   Corynebacterium variabile: CVAR_1869Help
Entry
CVAR_1869         CDS       T01594                                 

Gene name
dapE
Definition
(GenBank) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
cva  Corynebacterium variabile
Pathway
cva00300  Lysine biosynthesis
cva01100  Metabolic pathways
cva01120  Microbial metabolism in diverse environments
cva01230  Biosynthesis of amino acids
Module
cva_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:cva00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    CVAR_1869 (dapE)
Enzymes [BR:cva01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     CVAR_1869 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: AEK37220
UniProt: G0HF08
Position
complement(2150274..2151422)
Genome map
AA seq 382 aa AA seqDB search
MNEKTAQLDLTLDPVSLTAALVDIPSRSHEETVIADTLESGLVRLALPGVTVDRRGNTVI
ARTHRGLPTRVILAGHIDTVPPADNLPSRRGPDAAGADCIHGLGSVDMKSGDAVYIHAFV
TLAQSDDLAQDLTLVLYDGEEVASRYNGLKKVADTEPGLLAGDVALLGEPSGAVIEAGCQ
GTLRLKVTAHGTRAHSARAWLGDNAAHRLSPVIARIASYEPRDVDIDGCLYREGLNVVRL
ESGVATNTIPDEAWLFVNFRFAPDRSGEEALAHTLDVLGVGTPEEPADGFSLEIDDLSPA
ALPGLHRPAAAALVTATGGNVRAKYGWTDVARFSVLGIPAVNFGPGDPGLCHTPQENCPV
EMITTVSDQLISYLTTPPEIPA
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaaaagactgcacaactcgatctcaccctcgatccggtgtcactcaccgccgcg
ttggtggacattcccagccggtcccacgaggagaccgtgatcgccgacaccctggagtcc
ggactcgtccggctcgccctgcccggggtcacggtggaccgccgggggaacacggtcatc
gcccggacgcaccgtggactgcccacccgtgtcatcctcgccggccacatcgacaccgtt
ccgccggcggacaacctgccgtcgcgacggggtccggacgccgcgggcgcagactgcatc
cacgggctcggttccgtagacatgaagtccggggacgcggtgtacatccacgccttcgtc
accctcgcacagtcagatgacctggcccaggacctcacgctcgtgctctacgacggtgag
gaggtcgcctcgcgctacaacggcctgaagaaggtcgcggacaccgaacccggtctgctg
gccggtgacgtcgccctgctcggtgaaccctccggtgccgtcatcgaggcgggctgccag
ggcacactgcggctgaaggtcaccgcccacggcacccgggcccactccgcccgtgcctgg
ctcggggacaacgccgcccaccggctgtccccggtgatcgccaggatcgcgtcctacgaa
ccccgcgacgtcgacatcgacggctgcctctaccgtgaggggctcaacgtggtgcgactg
gaatccggggtggcgaccaacaccatcccggacgaggcgtggctgttcgtgaacttccgt
ttcgcgccggaccggtcgggggaggaggccctggcgcacaccctcgacgtcctgggcgtc
ggcacccccgaggaaccggcggacgggttctccctggagatcgacgacctgtccccggcc
gccctgcccggactgcaccggccggccgccgccgcactggtcacggccacgggcggcaat
gtccgggcgaaatacggctggaccgatgtcgcccggttctccgtcctgggcattcccgcg
gtgaacttcggccccggtgaccccggcctgtgccacaccccgcaggagaactgcccggtc
gagatgatcacgaccgtcagcgaccagctcatcagctacctcaccacaccgccggagatc
ccggcctga

DBGET integrated database retrieval system