KEGG   Corynebacterium variabile: CVAR_2084Help
Entry
CVAR_2084         CDS       T01594                                 

Gene name
fadA4
Definition
(GenBank) acetyl-CoA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cva  Corynebacterium variabile
Pathway
cva00071  Fatty acid degradation
cva00072  Synthesis and degradation of ketone bodies
cva00280  Valine, leucine and isoleucine degradation
cva00310  Lysine degradation
cva00362  Benzoate degradation
cva00380  Tryptophan metabolism
cva00620  Pyruvate metabolism
cva00630  Glyoxylate and dicarboxylate metabolism
cva00640  Propanoate metabolism
cva00650  Butanoate metabolism
cva00900  Terpenoid backbone biosynthesis
cva01100  Metabolic pathways
cva01110  Biosynthesis of secondary metabolites
cva01120  Microbial metabolism in diverse environments
cva01130  Biosynthesis of antibiotics
cva01200  Carbon metabolism
cva01212  Fatty acid metabolism
cva02020  Two-component system
Module
cva_M00095  C5 isoprenoid biosynthesis, mevalonate pathway
Brite
KEGG Orthology (KO) [BR:cva00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CVAR_2084 (fadA4)
   00630 Glyoxylate and dicarboxylate metabolism
    CVAR_2084 (fadA4)
   00640 Propanoate metabolism
    CVAR_2084 (fadA4)
   00650 Butanoate metabolism
    CVAR_2084 (fadA4)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CVAR_2084 (fadA4)
   00072 Synthesis and degradation of ketone bodies
    CVAR_2084 (fadA4)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CVAR_2084 (fadA4)
   00310 Lysine degradation
    CVAR_2084 (fadA4)
   00380 Tryptophan metabolism
    CVAR_2084 (fadA4)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CVAR_2084 (fadA4)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CVAR_2084 (fadA4)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CVAR_2084 (fadA4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cva04147]
    CVAR_2084 (fadA4)
Enzymes [BR:cva01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CVAR_2084 (fadA4)
Exosome [BR:cva04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CVAR_2084 (fadA4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt B12-binding
Motif
Other DBs
NCBI-ProteinID: AEK37436
UniProt: G0HHF6
Position
complement(2365666..2366874)
Genome map
AA seq 402 aa AA seqDB search
MSAASAQPAPTPEDIVIVGAARTAQGKMLGALASKTAVDLGATAISTALERAGVAAETVG
HVVMGQVVQAGAGQNPAKQAAVAAGVPVSTPADTVNKVCLSGLDAVIHGSRLLRLGDADV
VVAGGQESMTNAPHLAAGVRAGAKFGSLVLQDSLERDGLTDAVHGTAMGVETEEGNTTRG
ITRAEQDRVAARSHQRAEAAIAEGTFAEEIAPVEVKTRKGTVIVDTDEGVRPGTTEESLA
GLRPAFATDGTITAASASQISDGAAAVVLTTRAYAEANDLEVLAALAAYGQTAGPDTYLH
SQPAQAVAAALGKAGWEASDLDFLEINEAFAAVVVQSLRDLDYPLERTNIHGGGIALGHP
IGCSGARLVVAAAHELNRRGGGKAAVSLCGGGGQGDALILWR
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgagtgctgcatccgcccagcccgcccccacccccgaggacatcgtcatcgtcggtgcc
gcgcgcaccgcccagggcaagatgctcggggccctggcctccaagaccgcggtggacctc
ggtgcaaccgccatcagtaccgcgcttgagcgcgccggtgtcgccgccgagactgtcggc
catgtggtcatggggcaggtcgtgcaggccggcgccggtcagaacccggccaagcaggcg
gcggtggctgccggtgtgccggtctccaccccggccgacaccgtgaacaaggtctgcctg
tcgggtctggacgcggtgatccacgggtcccgtctgctgcgtctcggggacgccgacgtg
gtggtcgccggtggtcaggagtcgatgaccaatgcgccgcatctggctgccggtgtgcgg
gccggggcgaagttcggttccctggtgctgcaggattctctggagcgtgacgggttgact
gatgcggtgcacggtacggcgatgggggtggagactgaggagggtaacaccacccggggt
atcacccgtgctgagcaggaccgggttgccgcgagatcgcatcagcgggccgaggctgcg
attgctgaggggactttcgccgaggagatcgccccggtggaggtcaagacccgcaagggt
accgtcatcgtcgacaccgacgagggtgtgcgacccgggacgaccgaggagtcgctggcg
ggtctgcgtccggcgttcgccaccgacgggacgatcaccgcggcgtcggcctcgcagatc
tccgacggtgccgcggcggtcgtgctgaccacccgcgcgtatgcggaggccaacgatctt
gaggtccttgctgccctggctgcctacggtcagaccgcgggtccggacacctacctgcac
tcccagccggcgcaggcggtcgccgccgcgctgggtaaggccggctgggaggcgtcggat
ctggacttcctggagatcaacgaggcgttcgctgcggtggtggtgcagtcgctgcgggat
ctggactacccgctggagcggaccaatattcacggtggtggtattgcgttgggtcatccg
atcggttgctcgggtgcgcgtctggtcgtcgctgcggctcatgagctgaatcgtcggggc
ggcggtaaggccgccgtgtcgctgtgcggtggtggcggccaaggtgacgccctgatcctc
tggcgctga

DBGET integrated database retrieval system