KEGG   Corynebacterium variabile: CVAR_2767Help
Entry
CVAR_2767         CDS       T01594                                 

Gene name
aceA
Definition
(GenBank) Isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
cva  Corynebacterium variabile
Pathway
cva00630  Glyoxylate and dicarboxylate metabolism
cva01100  Metabolic pathways
cva01110  Biosynthesis of secondary metabolites
cva01120  Microbial metabolism in diverse environments
cva01200  Carbon metabolism
Module
cva_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:cva00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    CVAR_2767 (aceA)
Enzymes [BR:cva01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     CVAR_2767 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: AEK38106
UniProt: G0HG67
Position
3109438..3110727
Genome map
AA seq 429 aa AA seqDB search
MSNVGQPRTAAEIQKDWDENPRWANVTRDYTAEQVAELQGNVVEEHTLATRGAEILWDAV
NEPGDGYINALGALTGNQAVQQVRAGLKAVYLSGWQVAGDANLSGHTYPDQSLYPANSVP
SVVQRINNALSRADEIARVEGDTSVDNWLVPIVADGEAGFGGALNVYELQKAMINAGASG
THWEDQLASEKKCGHLGGKVLIPTKQHVRTLNSARLAADVANTPTVVIARTDAEAATLLT
SDVDERDHEFLTGERSAEGYYYVKNGIEPCISRAKSFAPYADMIWMETGTPDLELAKKFA
EGVRSEFPDQLLSYNCSPSFKWSAHLDDDEIAKFQNELGAMGFKFQFITLAGFHALNYSM
FDLAHGYARNQMSAFVDLQNREFEAESRGFTAVKHQREVGAGYFDRIATTVDPNSSTTAL
KGSTEEAQF
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaacgtcggacagccgcgtaccgccgccgaaatccagaaggactgggacgagaac
ccccgttgggccaacgtcacccgcgactacaccgccgagcaggttgccgagctccagggc
aacgtcgtcgaggagcacaccctcgccacccgcggtgccgagatcctctgggacgccgtg
aacgagccgggcgacggctacatcaacgccctcggtgccctgaccggtaaccaggccgtc
cagcaggtccgcgccggcctgaaggccgtctacctctccggttggcaggtcgccggtgac
gccaacctctccggccacacctacccggaccagtccctgtacccggcgaactccgttccg
tccgtggtccagcgcatcaacaacgccctctcccgcgccgacgagatcgcccgcgtcgag
ggtgacacctccgtcgacaactggctcgtcccgatcgtcgccgacggtgaggccggcttc
ggtggcgccctgaacgtctacgagctgcagaaggccatgatcaacgccggtgcctccggc
acccactgggaggaccagctggcctccgagaagaagtgcggccacctgggcggcaaggtc
ctcatcccgaccaagcagcacgtccgtaccctgaactccgcccgtctggccgccgacgtc
gccaacaccccgaccgtcgtcatcgcccgcaccgacgccgaggccgctaccctgctgacc
tccgacgtcgacgagcgcgaccacgagttcctcaccggtgagcgttccgccgagggctac
tactacgtcaagaacggcatcgagccctgcatctcccgtgcgaagtccttcgctccgtac
gccgacatgatctggatggagaccggtaccccggatctcgagctcgccaagaagttcgcc
gagggcgtccgctccgaattcccggaccagctcctgtcctacaactgctccccgtccttc
aagtggtccgcccacctggacgacgacgagatcgccaagttccagaacgagctgggcgcc
atgggcttcaagttccagttcatcaccctggccggcttccacgccctcaactactccatg
ttcgatctggcccacggctacgcccgcaaccagatgtccgccttcgtggacctgcagaac
cgcgagttcgaggccgagtcccgcggcttcaccgctgtcaagcaccagcgcgaggtcggc
gccggttacttcgaccgcatcgccaccaccgtggacccgaactcctccaccaccgccctc
aagggctccaccgaggaggcccagttctag

DBGET integrated database retrieval system