KEGG   Chromobacterium vaccinii: BKX93_04435Help
Entry
BKX93_04435       CDS       T04565                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cvc  Chromobacterium vaccinii
Pathway
cvc00071  Fatty acid degradation
cvc00072  Synthesis and degradation of ketone bodies
cvc00280  Valine, leucine and isoleucine degradation
cvc00310  Lysine degradation
cvc00362  Benzoate degradation
cvc00380  Tryptophan metabolism
cvc00620  Pyruvate metabolism
cvc00630  Glyoxylate and dicarboxylate metabolism
cvc00640  Propanoate metabolism
cvc00650  Butanoate metabolism
cvc00900  Terpenoid backbone biosynthesis
cvc01100  Metabolic pathways
cvc01110  Biosynthesis of secondary metabolites
cvc01120  Microbial metabolism in diverse environments
cvc01130  Biosynthesis of antibiotics
cvc01200  Carbon metabolism
cvc01212  Fatty acid metabolism
cvc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cvc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BKX93_04435
   00630 Glyoxylate and dicarboxylate metabolism
    BKX93_04435
   00640 Propanoate metabolism
    BKX93_04435
   00650 Butanoate metabolism
    BKX93_04435
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BKX93_04435
   00072 Synthesis and degradation of ketone bodies
    BKX93_04435
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BKX93_04435
   00310 Lysine degradation
    BKX93_04435
   00380 Tryptophan metabolism
    BKX93_04435
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BKX93_04435
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BKX93_04435
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BKX93_04435
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cvc04147]
    BKX93_04435
Enzymes [BR:cvc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BKX93_04435
Exosome [BR:cvc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BKX93_04435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AOZ52724
UniProt: A0A1D9LNH5
Position
1002346..1003524
Genome map
AA seq 392 aa AA seqDB search
MEVAIVAAQRTAIGSFGGGLAKIPAPELGATVIKALLEKTGVKPEDVSEVILGQVLTAGS
GQNPARQALIKAGLPVTTPATTLNVVCGSGLRAVHLAAQAILAGDADIVIAGGQESMSLS
PHILPGSRDGFRMGNAQLVDTMVNDGLTDAYNAYHMGITAENVAAKYGIGREEQDAFSLQ
SQQRAAAAQKTGKFKDEIVPVLVPQRKGDPLAFDADEFIKHDASAEGLAKLRAAFKKDGT
VTAGNASGINDGAAAVLLMSTQKADQLGLKPLAIIRGYALTGCEPEIMGIGPVSATRKAL
SKAAWKVEDLDLVEANEAFAAQALGVAKELGWGSDKVNVNGGAIALGHPIGASGCRVLVT
LLHEMQRRGAKKGLATLCIGGGMGVALAVERP
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atggaagtagcgatcgtagccgcgcaacgcaccgcaatcggcagcttcggcggcggattg
gccaaaatcccggcgccggagctgggcgccaccgtgatcaaggcgctgctggaaaaaacc
ggcgtcaagccggaagacgtcagcgaagtgatcctgggccaagtgctcaccgccggcagc
ggccagaacccggcccgccaggcgctgatcaaggccggcctgccggtcaccacccccgcc
accacgctgaacgtggtgtgcggctccggcctgcgcgccgtgcatctggcggcccaggcc
atcctggccggcgatgccgacatcgtcatcgccggcggccaggaaagcatgtcgctgtcc
ccgcacattctgccgggctcgcgcgacggcttccgcatgggcaacgcccaactggtggac
accatggtcaacgacggcctgaccgacgcctacaacgcctaccacatgggcatcaccgcc
gagaacgtggccgccaaatacggcatcggccgcgaagagcaggacgccttctcgctgcaa
tcgcagcagcgcgccgccgccgcccagaaaaccggcaagttcaaggacgagatcgtcccg
gtgctggtgccgcagcgcaagggcgacccgctggccttcgacgccgacgagttcatcaag
catgacgccagcgcggaaggtttggccaagctgcgcgcggccttcaagaaggatggcacc
gtcaccgccggcaacgcctccggcatcaacgacggcgccgccgccgtgctgctgatgtcc
acccagaaggccgatcagctgggcctgaaaccactggccatcatcaggggctacgcgctg
accggctgcgaaccggaaatcatgggcatcggcccggtgtccgccacccgcaaggcgctc
tccaaagccgcatggaaagtggaagacctggatctggtggaagccaacgaggccttcgcc
gcccaggcgctgggcgtggccaaggagctgggctggggctcggacaaggtcaacgtcaac
ggcggcgcgatcgcgctgggccacccgatcggcgcgtccggctgccgggtgctggtgacg
ctgctgcacgaaatgcagcgccgcggcgccaagaagggcctggccacgctgtgcatcggc
ggcggcatgggcgtggcgctggcggttgagcgcccgtaa

DBGET integrated database retrieval system