KEGG   Chromobacterium vaccinii: BKX93_09555Help
Entry
BKX93_09555       CDS       T04565                                 

Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
cvc  Chromobacterium vaccinii
Pathway
cvc00430  Taurine and hypotaurine metabolism
cvc00620  Pyruvate metabolism
cvc00640  Propanoate metabolism
cvc00680  Methane metabolism
cvc01100  Metabolic pathways
cvc01120  Microbial metabolism in diverse environments
cvc01200  Carbon metabolism
Module
cvc_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:cvc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BKX93_09555
   00640 Propanoate metabolism
    BKX93_09555
  09102 Energy metabolism
   00680 Methane metabolism
    BKX93_09555
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    BKX93_09555
Enzymes [BR:cvc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     BKX93_09555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase
Motif
Other DBs
NCBI-ProteinID: AOZ50218
UniProt: A0A1D9LG30
Position
2053391..2054542
Genome map
AA seq 383 aa AA seqDB search
MNRCLLAINAGSATLKFRAFSLDGQTLLARGMVDRFGSREALFSLADANGQKLAERGLAD
AAHDTALAAVLNGLADQGLEARAVAHRVVHGGNRFRQPARVDADTRAALDDYIALAPLHQ
PVSLAVIDAFSRIDPQLPQIACFDTAFHATQPTVATRFGIARHWHDEGVRRYGFHGLSYA
AIARRLPEIGLAHGKVVVCHLGSGASACAIESGKSVASSMGFSAVDGLMMGSRPGYIDPE
VILYWQEHEGMGVKDVRRELYKNSGLLGVSGVSADMRELLDSELPEAREAVELFCYRAAR
EAASLAGAMRGLDGLIFTAGIGEHSAEVRARILQQLSWLGFELDHAANLAHARRLTAAGS
RLPAYMLPTDEEGEMARQAARLL
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgttgcctgctggcgatcaacgctggttccgccaccctgaagttccgcgcgttc
tcgctggacggccagacgctgctggcgcgcggcatggtagaccgcttcggcagccgcgaa
gccctattctcgctggccgacgccaacggccagaagctggccgagcgcggcctggccgac
gccgcccacgacaccgcgctggcggcggtgctgaacggcctggccgatcaggggttggag
gcgcgggcggtggcgcaccgggtggtgcatggcggcaaccgcttccgccagccggcgcgg
gtggatgccgacactcgggcggcgctggacgactacatcgcgctggcgccgctgcaccag
ccggtcagcctggcggtgatagacgccttcagccggatagatccgcaactgccgcaaatc
gcctgcttcgacaccgccttccacgccacccagccgacggtggccacccgcttcggaatc
gcccgccactggcacgacgagggcgtgcgccgctacggcttccacggcctgtcctacgcc
gccatcgcgcggcggttgccggaaatcggcctggcccacggcaaggtggtggtctgccat
ctgggcagcggcgccagcgcctgcgcgatcgaatccggcaagagcgtggcgtccagcatg
gggttttcggcggtggacggcctgatgatgggcagccggcccggctatatcgacccggaa
gtgatcctgtattggcaggaacatgaaggcatgggagtgaaggacgtgcggcgcgagctg
tacaaaaactccggcctgctgggcgtgtccggcgtgtcggccgacatgcgcgaactgctg
gacagcgaactgccggaggcgcgcgaggcggtggagctgttctgctaccgggcggcgcgc
gaggcggccagcctggccggggcgatgcgcggcctggacggactgatcttcaccgccggc
ataggcgaacactctgccgaggtgagggccaggatattgcagcagctgtcctggctggga
ttcgagctggaccacgcggccaacctcgcccacgcgcggcggctcaccgcagccggcagc
cgtctgccggcctatatgctgcccaccgacgaggaaggcgagatggcccgccaggcggca
cggctgctgtag

DBGET integrated database retrieval system