KEGG   Chromobacterium vaccinii: BKX93_14340Help
Entry
BKX93_14340       CDS       T04565                                 

Definition
(GenBank) two-component system response regulator OmpR
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
cvc  Chromobacterium vaccinii
Pathway
cvc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cvc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BKX93_14340
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:cvc02022]
    BKX93_14340
Two-component system [BR:cvc02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   BKX93_14340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C AHJR-like FleQ
Motif
Other DBs
NCBI-ProteinID: AOZ51053
UniProt: A0A1D9LIK6
Position
complement(3098102..3098833)
Genome map
AA seq 243 aa AA seqDB search
MEHNKILVVDDDAKLRELLTRYLTQQGYIVETLPDPKDLDRKLARNRPDLIVLDVMMPGE
DGLAVVRRLRAQGESLPVIMLTARGEDIDRILGLEMGADDYLPKPFNPRELTARIQSVLR
RHHTTPALAALHDADDVVEFGEFVLNLGQRELRRGGQPVSLTSAEFAVLSVLVSHPRRPL
TREQLMELALGKGNGESLDRSIDVHISRLRKALENGESDSQLRYIQTVWGYGYVFVPDGS
PRE
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atggaacataataaaatcctggtcgtcgacgacgacgccaagctgcgcgaactgctgacc
cgctacctgacccagcagggctatatcgtggaaacgctgcccgatcccaaggatctggac
cgcaagctggcgcgcaaccgtcccgacctgatcgtgctggacgtgatgatgccgggcgag
gacgggctggcggtggtgcgccggctgcgcgcccagggcgaatcgctgccggtgatcatg
ttgaccgcccgcggcgaggacatcgaccgcatcctgggcctggaaatgggcgccgacgac
tacctgcccaagcccttcaatccgcgcgagctgaccgcccgcatccagtcggtgctgcgc
cgccatcacaccacgccggcgctggccgcgctgcacgacgccgacgacgtggtggagttc
ggcgagttcgtgctcaacctcggccagcgcgagctgcgccgcggcggccagccggtgtcg
ctgaccagcgccgaattcgcggtgttgtcggttctggtcagccatccgcgccgcccgctg
acccgcgaacagctgatggagctggcgctgggcaagggcaacggcgaatcgctggaccgc
agcatcgacgtgcacatctcccgcctgcgcaaagcgctggaaaacggcgaaagcgacagc
cagctgcgctacatccagaccgtgtggggctacggctacgtgttcgtgccggacggatcg
cccagggagtag

DBGET integrated database retrieval system