KEGG   Chromobacterium vaccinii: BKX93_15840Help
Entry
BKX93_15840       CDS       T04565                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
cvc  Chromobacterium vaccinii
Pathway
cvc00260  Glycine, serine and threonine metabolism
cvc01100  Metabolic pathways
cvc01110  Biosynthesis of secondary metabolites
cvc01120  Microbial metabolism in diverse environments
cvc01130  Biosynthesis of antibiotics
cvc01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cvc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BKX93_15840
Enzymes [BR:cvc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     BKX93_15840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase DegT_DnrJ_EryC1 Aminotran_1_2 Cys_Met_Meta_PP OKR_DC_1
Motif
Other DBs
NCBI-ProteinID: AOZ51330
UniProt: A0A1D9LJ70
Position
3421548..3422576
Genome map
AA seq 342 aa AA seqDB search
MQWIDFRSDTVTHPTPAMRRAMAEAEVGDDVYGDDPTVLRLEELAADKLGKEAALFVPSG
TFGNQLALFTHCRRGDEVIVEDNSHIVWHEAGAAAVIAGAHMRTIEGDNGLMAVDAIERR
IRVGDDIHEPRTGLICLENAHGNGRVLPLSAMADTAALAREHGVPVHLDGARVFNAAAHL
GCDAREITRHVDSVMACLSKGLAAPIGSILAGSADFIAQARRKRKLLGGGMRQAGVIAAP
GILALSEMAARLDEDHQNARYLAEGLAKLPCVDIDPADVHINLVWFRFNADIDAAELMSA
LKQAGFLANPPHQGAMRLVTHWQVGRADIDRLLDVMQRVLSD
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgcagtggatagactttcgcagcgataccgtcacccacccgacgccggcgatgcgccgc
gcgatggccgaggccgaggtcggcgacgacgtctacggcgacgaccccaccgtgctgagg
ctggaggagctggccgccgacaagctgggcaaggaggcggcgctgttcgtccccagcggc
accttcggcaaccagctggcgttgttcacccactgtcgccgcggcgacgaggtgatcgtc
gaggacaacagccatatcgtctggcacgaggccggcgcggcggcggtgatcgccggcgcc
cacatgcgcacgatagaaggcgacaacggcctgatggcggtggacgcgatcgagcgccgc
atccgcgtcggcgacgacatccacgagccgcgcaccggcctgatctgcctggagaacgcc
cacggcaatggccgcgtgctgccgctgtcggcgatggccgacaccgcggcgctggcgcgc
gagcacggcgtgccggtccacctggacggcgcgcgggtgttcaacgccgccgcccatctg
ggttgcgacgcgcgcgagatcacccgccacgtcgacagcgtgatggcctgtctgtccaag
ggcctggccgcgccgatcggctccattctggccggctccgccgacttcatcgcccaggcg
cgccgcaagcgcaagctgctgggcggcggcatgcgccaggccggcgtgatcgccgcgccc
ggcatcctggcgctgagcgaaatggcggcgcggctggacgaagaccaccagaatgcccgt
tacctggccgagggcctggccaagctgccgtgcgtggacatcgatccggccgacgtccac
atcaacctggtgtggttccgcttcaacgccgacatcgacgccgccgagctgatgtcggcg
ttgaagcaggccggtttcctggccaacccgccgcatcagggcgcgatgcggctggtcacc
cactggcaggtggggcgcgccgacatcgaccggctgctggacgtgatgcagcgcgtgctc
agcgactga

DBGET integrated database retrieval system