KEGG   Chromobacterium vaccinii: BKX93_16560Help
Entry
BKX93_16560       CDS       T04565                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
cvc  Chromobacterium vaccinii
Pathway
cvc03010  Ribosome
Brite
KEGG Orthology (KO) [BR:cvc00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BKX93_16560
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:cvc03011]
    BKX93_16560
Ribosome [BR:cvc03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    BKX93_16560
  Bacteria
    BKX93_16560
  Archaea
    BKX93_16560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AOZ51451
UniProt: A0A1D9LJS2
Position
3568386..3568715
Genome map
AA seq 109 aa AA seqDB search
MRVSANLKSVRLSAQKCRLVADLVRGQSVAQALNILAFSPKKGAVIIKKVLESAIANAEH
NEGADIDTLRVTSIFVDKGASLKRFTARAKGRGNRIEKQTCHISLTVGN
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atgagagtatctgcaaatctgaaaagtgttcgcctttcggctcaaaagtgccgtctggta
gccgatctggtccgcggtcagtccgtggcccaggcgctgaatatcctggccttctccccg
aagaagggcgcggtaatcatcaagaaagtgctggaatctgcaatcgctaacgccgagcac
aacgaaggcgctgacatcgacaccctgcgtgtcaccagcatctttgttgacaagggcgct
agtctgaagcgtttcactgcccgtgctaagggtcgtggcaatcgcatcgaaaagcagacc
tgccacatttccttgaccgttggcaattaa

DBGET integrated database retrieval system