KEGG   Chromobacterium vaccinii: BKX93_18425Help
Entry
BKX93_18425       CDS       T04565                                 

Definition
(GenBank) dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cvc  Chromobacterium vaccinii
Pathway
cvc00020  Citrate cycle (TCA cycle)
cvc00310  Lysine degradation
cvc00380  Tryptophan metabolism
cvc01100  Metabolic pathways
cvc01110  Biosynthesis of secondary metabolites
cvc01120  Microbial metabolism in diverse environments
cvc01130  Biosynthesis of antibiotics
cvc01200  Carbon metabolism
Module
cvc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cvc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cvc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BKX93_18425
  09105 Amino acid metabolism
   00310 Lysine degradation
    BKX93_18425
   00380 Tryptophan metabolism
    BKX93_18425
Enzymes [BR:cvc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     BKX93_18425
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H
Motif
Other DBs
NCBI-ProteinID: AOZ51775
UniProt: A0A1D9LKJ2
Position
3958436..3959671
Genome map
AA seq 411 aa AA seqDB search
MLIEVKVPQLPESVSEATLMSWHKKVGEFVKRDENLIDLETDKVVLELPAPQAGVVVEII
EQDGATVTSGQLIAKIDTAAKAGDAAPAAAAAPAPAAAAPVQAAPAAGAAAMPSAAKLAA
ETGVDLSKVAGSGRDGRVLKEDVQAAKQAAPAQAGPVIGSGGALSTTPTAVNVAGILSGR
AEQRVPMSRLRQRVAERLIMSQQTNAILTTFNEVNMKPVMDLRAKYKDKFEKEHGIKLGF
MGFFVKAVVAALKKYPIVNASVDGNDIVYHGYFDIGVAVGSPRGLVVPVIRNADQLSLAD
IEKQIAEFGKRAQEGKLTVEELTGGTYTISNGGTFGSMMSTPIINPPQSAILGMHATKER
AVVENGQVVVRPMMYLAQSYDHRIIDGREAVLSLVAIKDAIEDPARLLLDL
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgctgattgaagtcaaagtcccgcaactgcccgaatccgtatccgaagccacgctgatg
agctggcacaagaaggttggcgagttcgtcaaacgcgacgaaaacctgatcgatctggaa
accgacaaggtggtgctggaactgccggcgccgcaagccggcgtggtggtggaaatcatc
gagcaggatggcgccaccgtgacctccggccagctgatcgccaagatcgataccgccgcc
aaggcaggcgacgccgctccggccgccgccgcagccccggcgcccgccgccgccgctccg
gtgcaggccgctccggccgccggcgccgccgcgatgccgtccgcagccaagctggccgcg
gaaaccggcgtggacctgtccaaggtggccggctccggccgcgacggccgcgtgctgaag
gaagacgtgcaggccgccaagcaagccgctccagcccaggccggcccggtgatcggttcc
ggcggcgcgctgtccaccaccccgaccgccgtcaacgtggccggcatcctgtccggccgc
gccgagcagcgcgtgccgatgtcccgtctgcgccagcgcgtggccgagcgtctgatcatg
tcgcagcagaccaacgccatcctcaccaccttcaatgaagtgaacatgaagccggtgatg
gacctgcgcgccaagtacaaggacaagttcgagaaagagcacggcatcaagctgggcttc
atgggcttcttcgtcaaggccgtggtcgccgcgctgaagaaatacccgatcgtcaacgct
tcggtggacggcaacgacatcgtctaccacggctacttcgacatcggcgtggccgtgggc
agcccgcgcggcctggtggtgccggtgatccgcaacgccgaccagctgtcgctggccgac
atcgagaagcagatcgccgaattcggcaagcgcgcccaggaaggcaagctgaccgtggaa
gagctgaccggcggcacttacaccatctccaacggcggcaccttcggctcgatgatgtcc
accccgatcatcaacccgccgcaatcggcgatcctgggcatgcacgccaccaaggagcgc
gccgtggttgagaacggtcaagtggtggtgcgtccgatgatgtatcttgcccaatcctac
gaccaccgcatcatcgacggtcgcgaagcggtgctgagcctggtggcgatcaaggacgcc
atcgaggatccggcgcgtctgctgctcgacctgtaa

DBGET integrated database retrieval system