KEGG   Chromobacterium vaccinii: BKX93_19135Help
Entry
BKX93_19135       CDS       T04565                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
cvc  Chromobacterium vaccinii
Pathway
cvc00450  Selenocompound metabolism
cvc00970  Aminoacyl-tRNA biosynthesis
cvc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cvc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    BKX93_19135
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BKX93_19135
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cvc01007]
    BKX93_19135
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cvc03016]
    BKX93_19135
Enzymes [BR:cvc01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     BKX93_19135
Amino acid related enzymes [BR:cvc01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   BKX93_19135
Transfer RNA biogenesis [BR:cvc03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    BKX93_19135
 Prokaryotic type
   Other AARSs
    BKX93_19135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 Anticodon_1 tRNA-synt_1e tRNA-synt_1f DALR_1 pXO2-34 HlyD_D23
Motif
Other DBs
NCBI-ProteinID: AOZ51898
UniProt: A0A1D9LKR8
Position
4118632..4120692
Genome map
AA seq 686 aa AA seqDB search
MTKRKILVTSALPYANAGLHLGHMLEQIQTDIWVRFQKMRGHECYYVCADDTHGAPIMLA
AEKRGITPEQLVNEVRELHVADSQGFLIGHDNYYSTNSPENKALAEQVYLALKADDKIAC
RTIEQLFDPEKQMFLPDRFVKGECPKCSSKDQYGDNCEVCGATYAPTELKNPYSAVSGAK
PVLKTSEHYFFRLGECADFLKAWTSGSSRRADGAVQQHLQPESLNKMNEWIGGGLQDWDI
SRDAPYFGFEIPGAPGKYFYVWLDAPIGYMASFKNLCERLSLNFDEWFAKDSQTEMYHFI
GKDILYFHALFWPAMLNYSGLRSPTGVFAHGFLTVDGQKMSKSRGTFIQAKSYLDCGLNP
EWMRYYIAAKLNGRIEDIDLNLNDFVARVNSDLVGKFVNIASRSAGFIAKRFDGMLAAQV
SDGEILAKLQAAAEELAAAYEAREYAKALRDVMALADIVNGYVDANKPWELAKQEGQDAR
LQDVCTVLVNAFRLLAIYLKPVLPKLAEGVEAFLDVSPLSWSDAETLLLGKKINAYQHLM
QRIDPALIDKLIEANKQNMQATQDAPAAATHEPLAETIKIDDFAKVDLRVGKVLECNFVE
GSDKLLQFKVDLGFETRNIFSGIRKAYQEPEKLVGRHVIVVANLAERKMRFGVSQGMIVC
ASGVDDSEGLFLLDVDAGVKPGMRVG
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaacgcaagattctggtgaccagcgcgctgccttacgccaacgcggggctgcac
ctgggccacatgctggaacagatccagaccgatatctgggtgcgcttccagaagatgcgc
ggccacgaatgctattacgtgtgcgccgacgacacccacggcgcgcccatcatgctggcc
gccgagaagcgcggcatcacgcccgagcagctggtgaatgaagtgcgcgagctgcacgtc
gccgattcgcagggtttcctgatcggccacgacaactactacagcaccaacagcccggaa
aacaaggcgctggcggagcaggtttacctggccctgaaggccgacgacaagatcgcctgc
cgcaccatcgagcagctgttcgacccggaaaagcagatgttcctgccggaccgcttcgtc
aagggcgaatgcccgaagtgttcctccaaggaccagtacggcgacaactgcgaagtctgc
ggcgccacctacgcgccgaccgagctgaagaacccgtactcggcggtgtccggcgccaag
ccggtgctgaaaacctccgagcactacttcttccgcctgggcgaatgcgcggacttcctg
aaggcctggaccagcggctccagccgccgcgccgacggcgccgtgcagcagcacttgcag
ccggaatcgctgaacaagatgaacgagtggatcggcggcggcctgcaggattgggacatc
agccgcgacgcgccgtacttcggcttcgagattccgggcgcgccgggcaagtacttctat
gtgtggctggacgcgccgatcggctacatggccagcttcaagaatctgtgcgagcgcctg
agcctgaacttcgacgagtggttcgccaaggacagccagaccgagatgtaccacttcatc
ggcaaggacattctgtacttccacgcgctgttctggccggcgatgctgaattactccggc
ctgcgctctccgaccggcgtgttcgcccacggcttcctgaccgtggacgggcagaagatg
tccaagtcgcgcggcaccttcatccaggccaagagctatctggattgcggcctgaatcca
gagtggatgcgctactacatcgccgccaaactgaacggccgcatcgaggacatcgatctc
aacctgaacgacttcgtcgcgcgggtgaactccgacctggtcggcaagttcgtcaacatc
gccagccgctccgccggcttcatcgccaagcgcttcgacggcatgctggccgcccaggta
tccgacggcgagatcctggccaagctgcaggccgcggctgaagagctagccgcagcctac
gaggcgcgcgaatacgcgaaggcgctgcgcgacgtgatggcgctggccgacatcgtcaac
ggctatgtggacgccaacaagccgtgggagctggccaagcaggaaggccaggacgcgcgc
ctgcaggacgtgtgcaccgtgctggtcaacgccttccgcctgctggccatctacctgaag
ccggtgctgccaaagctggccgagggcgtggaagcctttctggatgtgtcgccgctgtcc
tggagcgacgcggaaaccctgctgctgggcaaaaagatcaatgcctaccagcacctgatg
cagcgcatcgacccggcgctgatcgacaaattgatagaagcgaacaagcagaatatgcaa
gctacccaagacgcgccggccgccgccacgcacgagccgctggccgaaaccatcaagatc
gacgacttcgccaaggtggacctgcgcgtaggcaaggtgctggagtgcaatttcgtcgaa
ggctcggacaagctgctgcagttcaaggtggatctgggcttcgagacccgcaacatcttc
tccggcatccgcaaggcctatcaggagccggaaaagctggtcggccgccacgtgatcgtg
gtcgcgaacctggccgagcgcaagatgcgcttcggcgtgtcgcagggcatgatcgtctgc
gcgtccggcgtggacgacagcgaaggcctgttcctgctggacgtggacgcaggcgtcaag
ccgggcatgcgcgtcggctga

DBGET integrated database retrieval system