KEGG   Chromobacterium vaccinii: BKX93_19965
Entry
BKX93_19965       CDS       T04565                                 

Definition
(GenBank) hypothetical protein
  KO
K19974  2-epi-5-epi-valiolone 7-phosphate 2-epimerase [EC:5.1.3.35]
Organism
cvc  Chromobacterium vaccinii
Pathway
cvc00525  Acarbose and validamycin biosynthesis
cvc01100  Metabolic pathways
cvc01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cvc00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00525 Acarbose and validamycin biosynthesis
    BKX93_19965
Enzymes [BR:cvc01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.35  2-epi-5-epi-valiolone 7-phosphate 2-epimerase
     BKX93_19965
SSDB
Motif
Pfam: AP_endonuc_2
Other DBs
NCBI-ProteinID: AOZ52042
UniProt: A0A1D9LLD8
Position
4292430..4293260
AA seq 276 aa
MGAVKRGREVALADWRLPLSGPDAVRLAAWCGAEWLQLDFGGPGRAPRLDEPGRLEAVQA
ASSEHGVGLAGLAVNALNDIGLHAARNSAAGVLARRTVEDALATATALSMPLMFLPSFRL
SEIRDEGALSRSAELLGWACRLAEGSGVAIASENVLAPRQVQRLLELANHPGLWLVLDTY
NPVRAGIDLQAWMEALSGRIHRQIHVKDGLAGAPAALGRGDGDVAATLERLSHSDGRLHV
LENDYRGRGGWDLLRDDLAWLRALRLPSLELNEAQG
NT seq 831 nt   +upstreamnt  +downstreamnt
gtgggggctgtcaagcgcggacgcgaggtcgcgctggccgactggcgcttgccgttgtcc
ggccccgatgcggtgcgtttggccgcctggtgcggcgcggagtggctgcagctggatttt
ggcgggccgggccgtgcgccgcggttggatgagcctggccggttggaggcggttcaggcg
gcaagctccgagcatggggtcggcctggcgggattggcggtcaatgctttgaacgacatc
ggcctgcatgcggcaaggaactccgctgcgggcgtcctggctcggcggaccgtggaagac
gcgctggctacggctacggcgctctccatgccgctgatgtttctacccagtttccgtttg
agcgaaatccgggatgaaggcgcgctgagccgcagcgccgagctgttggggtgggcctgc
cgtttggccgagggcagcggcgtcgccatcgccagcgaaaacgttttggcgccgcggcag
gtccagcgtttgctggaactggcgaatcatccaggactgtggctggtgctggatacgtac
aacccggttcgggcgggcatcgatttgcaggcctggatggaggcgctgtctggccggatt
catcggcagattcatgtcaaggacgggctggccggcgctcctgccgcgctggggcgtggg
gatggcgacgtagccgccacgctggagaggctgagtcattccgatggccggctgcatgtc
ctggaaaacgattatcgcggtagaggcggctgggatctattgcgggatgaccttgcatgg
ctaagggcgctgcggctcccttccctcgaacttaatgaagcgcaaggctga

DBGET integrated database retrieval system