KEGG   Chromobacterium vaccinii: BKX93_21040Help
Entry
BKX93_21040       CDS       T04565                                 

Definition
(GenBank) cobyric acid synthase CobQ
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
cvc  Chromobacterium vaccinii
Pathway
cvc00860  Porphyrin and chlorophyll metabolism
cvc01100  Metabolic pathways
Module
cvc_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:cvc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BKX93_21040
Enzymes [BR:cvc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     BKX93_21040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 AAA_26 CbiA MobB
Motif
Other DBs
NCBI-ProteinID: AOZ52992
UniProt: A0A1D9LP06
Position
4543761..4545242
Genome map
AA seq 493 aa AA seqDB search
MTAKTIMIQGATSDAGKSALATGLCRLLARRGVRVAPFKPQNMALNSAVTADGGEIGRSQ
AVQALACRVEPHTDMNPVLLKPNSHTGSQVIIQGRAIGNMEARGYHGYKPVAMQAVLESH
ARLAEQYQCIVAEGAGSPAEINLRDGDIANMGFAEAVDCPVILVADIERGGVFAHLAGTL
ALLSESERARVVGLVINRFRGDPSLLQTGVDWLEQHTGKPVLGVLPYLYDLHLEAEDSMG
LDKPGGASGGGDKLRVVAPAAPRVSNHTDFDPLRLHPQVEFTLARAGQPIPAADLIVLPG
SKNVLADLAWLRAQGWEEALRRHLRYGGKVLGICGGLQMLGKKLHDPDGLESEPGSGDGL
GWLDMETTLAPEKRLTRMRGRLTLDDVEAAGYEIHMGVSQGPALARPAVRFDDGSADGAR
SEDDQIFATYLHGVFDEPAACQAILRWAGLAEPEALDYPALRETNIDKLADMLEKHLNLE
PIAAWLPSGVIPA
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccaaaaccatcatgatccagggcgccacgtccgacgccggcaagagcgcgctg
gccaccggcctgtgccgtctgctggcccggcgcggcgtgagggtggcgccgttcaagccg
cagaacatggcgctgaacagcgcggtgacggctgacggcggcgagatcggccgctcgcag
gcggtgcaggcgctggcctgccgcgtggagccgcacaccgatatgaacccggtgctgctc
aagcccaacagccataccggctcgcaggtgatcatccagggccgcgccatcggcaatatg
gaggcgcgcggctatcacggctacaagccggtcgcgatgcaggcggtgctggagtcgcac
gccaggttggcggaacagtatcaatgcatcgtcgccgagggcgccggcagcccggcagag
atcaatctgcgcgacggcgacatcgccaatatgggctttgccgaggcggtggactgcccg
gtgattctggtggccgacatcgagcgcggcggcgtgttcgcccacctggccggtacgctg
gcgttattgtccgaatccgagcgcgcgcgcgtggtcggcctggtgatcaaccgcttccgc
ggcgatccgtccctgctccagaccggcgtcgactggctggagcagcacaccggcaagccg
gtgctgggcgtgctgccctatctgtacgacctgcatctggaggccgaggacagcatgggc
ctggacaagcccggcggcgcgtcgggcggcggcgacaagctgcgcgtggtcgcgccggcc
gcgccgcgcgtcagcaaccacaccgatttcgatccgttgcgcctgcatccgcaggtggag
ttcacgctggcgcgtgccggacagcccatcccggcggccgacctgatcgtcctgccgggc
agcaagaacgtgctggccgacctggcctggctgcgcgcccagggctgggaggaggcgctg
cgccgccatctgcgctacggcggcaaggtactgggcatctgcggcggcctgcagatgctg
ggcaagaagctgcacgatccggatggattggaaagcgagccgggcagcggcgacggcctg
ggctggctggacatggaaaccaccctggcgccggagaagcggctgacgcggatgcgcggc
cggctgacattggatgatgtcgaagccgccggctacgaaatccacatgggggtgagccaa
gggccggccttggccaggcccgcggtgagattcgacgacggctcggccgacggcgcgcgc
tcagaagacgaccagatcttcgccacctatctgcacggcgtgttcgacgaacccgccgcc
tgccaggccatcctgcgctgggcggggctggccgagccggaggcgctggactacccggcg
ctgcgcgagaccaatatcgacaagctggcggacatgctggagaagcatctcaatctggag
ccgatagcggcgtggttgccaagcggcgtcataccagcctga

DBGET integrated database retrieval system