KEGG   Chromobacterium vaccinii: BKX93_21165Help
Entry
BKX93_21165       CDS       T04565                                 

Definition
(GenBank) 2,4-diacetylphloroglucinol biosynthesis protein
  KO
K22839  2-acetylphloroglucinol acetyltransferase [EC:2.3.1.272]
Organism
cvc  Chromobacterium vaccinii
Brite
KEGG Orthology (KO) [BR:cvc00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BKX93_21165
Enzymes [BR:cvc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.272  2-acetylphloroglucinol acetyltransferase
     BKX93_21165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N ketoacyl-synt Thiolase_C ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AOZ52263
UniProt: A0A1D9LM53
Position
complement(4576224..4577420)
Genome map
AA seq 398 aa AA seqDB search
MSARRVAIVAAAYTPKPGSSRVRQTFKEMIVESSYQALANAGMDAREIQGVAYGYHGEGI
SEYGGLGPTISDTLGVSPAPTFITSSNCTSSSVSFQMGHQMVASGEYDIVLCGGFEKMTD
HFNYAEYIGSSTECEYDYFLGISHTDAFALATSEYFHRYGYAGREADVLAAFGRQMRVYA
HNTPTATRYGQPIPSLDELKKSEAHGSMLAWGEASGCAILVAEHLAHKYTDKPVFIKGCA
YTGVSHYFGTRYHNPTLRHPGLATDTGMALSANSVACAEIAYKKAGISAKDIDVAQVYDL
LGAGLIQMESMGICKPGQAGHFVLEGGIAIDGETPLNTDGGNIGRGHASGCDGILHITEL
FRQLRGESDNQVKNARIAVSQNLGGYAAHNSVIVLGNE
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcacgacgcgtcgccatcgtggccgcggcctacacgcccaagccgggcagcagc
cgggtccgccagactttcaaggaaatgatcgtcgagtcgtcctaccaggccttggccaac
gccggcatggacgcccgcgaaatccagggcgtggcctatggctaccacggcgagggcatc
tcggaatacggcggcctgggcccgaccatttccgacacgctgggcgtcagccccgccccc
accttcatcaccagctcgaactgcaccagcagctcggtatcgttccagatgggccaccag
atggtcgcgtccggcgagtacgacatcgtgttgtgcggcggcttcgagaagatgaccgac
catttcaactacgccgaatacatcggctccagcaccgagtgcgagtacgactacttcctg
ggcatctcgcacaccgacgccttcgcgctggccacctcggaatacttccaccgctacggc
tacgccggccgcgaagccgacgtgctggccgccttcggccgccagatgcgcgtctacgcc
cacaacacgccgaccgccacccgctacggccagcccatcccctcgctggacgagctgaag
aaaagcgaggcgcacggctcgatgctggcctggggcgaggccagcggctgcgcgatcctg
gtggccgagcacctggcgcacaagtacaccgacaagccggtgttcatcaaaggctgcgcc
tacaccggcgtgtcgcattacttcggcacccgctaccacaatccgacgctgcgccacccg
ggcctggccaccgacaccggcatggcgctgtccgccaactcggtcgcctgcgccgagatc
gcctacaagaaggccggcatcagcgccaaggacatcgacgtggcccaggtctacgacctc
ttgggcgccggcctgatccagatggaatcgatgggcatctgcaagcccggccaggccggc
cacttcgtgctggaaggtggcatcgccatcgacggcgaaacgccgctgaacaccgacggc
ggcaacatcggccgcggccacgcctccggctgcgacggcatcctgcacatcaccgagctg
ttccgccagctgcgcggcgaatccgacaaccaggtgaagaacgcgcgcatcgcggtctcg
caaaacctcggcggctacgccgcccacaactcggtcatcgtactgggcaacgaataa

DBGET integrated database retrieval system