KEGG   Cyprinodon variegatus (sheepshead minnow): 107081333Help
Entry
107081333         CDS       T06110                                 

Definition
(RefSeq) eukaryotic translation initiation factor 3 subunit A-like
  KO
K03254  translation initiation factor 3 subunit A
Organism
cvg  Cyprinodon variegatus (sheepshead minnow)
Pathway
cvg03013  RNA transport
Brite
KEGG Orthology (KO) [BR:cvg00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    107081333
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:cvg03012]
    107081333
Translation factors [BR:cvg03012]
 Eukaryotic type
  Initiation factors
   eIF-3
    107081333
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 107081333
NCBI-ProteinID: XP_015225016
Position
Unknown
AA seq 397 aa AA seqDB search
MISLFKIFICFVPLQQERDEHNQQAIAAYLKNARKDHQRILARRQTIEERKERLESLNIQ
REKEELEQREAELQKVRKAEEERLRQEAKEREKERIMQEHEQIKKKTVRERLEQIKKTEL
GAKAFKDIDIEDLEELDPDFIMAKQVEQLEKEKKELQERLKNQEKKIDYFERAKRLEEIP
LIKKAYEEQRVKDMELWELQEEERINNLKIEREKALEHKKRMSRMMEDKESFLAKITAAR
SFIYEEKLKTFEERLVEERKKRLEERKKQRKEDRRNAYYRQKEEEAQRIHEEQLKKEREE
RERLEQERREEEEREYQERLRKLEEQERKQRARQQEIEERMRQKTISPQEKPPKVTKTDL
ESLWNRTTTESFGSHLNTVAYFHSSHFFCPPPLRPSI
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgattagtctttttaaaatttttatttgttttgttcccctccagcaagagcgtgacgaa
cataatcagcaggctatcgctgcgtacctgaaaaacgctcgcaaggatcaccagcgcatc
ctggcccgtagacagaccatcgaagagcgaaaggagcgcctggaaagcctgaacatccag
cgagagaaggaggagctggagcagcgagaggctgagctgcagaaggtccgcaaggccgag
gaggagcgtctgcggcaggaggccaaagagcgggagaaggagcgcatcatgcaggagcac
gaacagatcaagaagaagacggtccgcgaacggctggagcagatcaagaaaactgaactg
ggagccaaagccttcaaggatatcgacatcgaggacctggaggagctggatccagatttc
atcatggctaaacaggtggagcagctggagaaggagaaaaaggaacttcaggagcgtctg
aagaaccaggagaagaagattgattactttgagagggcaaaacgcctggaggagattcct
ctgatcaagaaagcttatgaggagcagcgtgtcaaagacatggagttgtgggagctccaa
gaggaggagaggatcaataacttgaagatcgagcgtgaaaaggctctggagcataagaag
cggatgtccaggatgatggaggacaaggagagcttcctggctaaaataacagccgcccgc
agcttcatctacgaggagaaattaaagacattcgaggagcgtttggttgaggagaggaaa
aagcgcctggaagagaggaagaagcagcgcaaggaagaccgccgtaacgcttactaccgc
cagaaggaggaggaggctcagcgcatccatgaggagcagctcaagaaggaacgcgaagag
cgtgagcggctggaacaagaacggcgtgaggaggaggagcgcgaataccaggagcgcctc
cgcaaactggaggagcaggaacgtaagcagcgcgctcgtcagcaggagatcgaggagcgg
atgcggcagaagaccatcagcccacaagaaaaaccacccaaggtaacaaaaactgacctg
gagagtttgtggaacagaaccacaacagaaagctttggttctcatttaaatacagtagct
tattttcattcttcccactttttctgcccaccccccctcagaccatctatttaa

DBGET integrated database retrieval system