KEGG   Cyprinodon variegatus (sheepshead minnow): 107081674Help
Entry
107081674         CDS       T06110                                 

Gene name
rock1
Definition
(RefSeq) rho-associated protein kinase 1
  KO
K04514  Rho-associated protein kinase 1 [EC:2.7.11.1]
Organism
cvg  Cyprinodon variegatus (sheepshead minnow)
Pathway
cvg04270  Vascular smooth muscle contraction
cvg04350  TGF-beta signaling pathway
cvg04510  Focal adhesion
cvg04530  Tight junction
cvg04810  Regulation of actin cytoskeleton
cvg05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:cvg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    107081674 (rock1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107081674 (rock1)
   04530 Tight junction
    107081674 (rock1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107081674 (rock1)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107081674 (rock1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107081674 (rock1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cvg01001]
    107081674 (rock1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cvg03036]
    107081674 (rock1)
Enzymes [BR:cvg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     107081674 (rock1)
Protein kinases [BR:cvg01001]
 Serine/threonine kinases: AGC group
  DMPK family [OT]
   107081674 (rock1)
Chromosome and associated proteins [BR:cvg03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    107081674 (rock1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Rho_Binding Cortex-I_coil C1_1 Pkinase_C HR1 Filament APH
Motif
Other DBs
NCBI-GeneID: 107081674
NCBI-ProteinID: XP_015225351
Position
Unknown
AA seq 1328 aa AA seqDB search
LLDGLDALVYDLDFPALRKNKSIDNFLNRYKKTISKIRDLRMKAEDYEVVKVIGRGAFGE
VQLVRHKSTHKVYAMKLLSKFEMIKRSDSAFFWEERDIMAFANSPWVVQLFFAFQDDRYL
YMVMEYMPGGDLVNLMSNYDVPEKWARFYTAEVVLALDGIHSMGFIHRDVKPDNMLLDKS
GHLKLADFGTCMKMNEDGMVQCDTAVGTPDYISPEVLKSQGGNGNYGRECDWWSVGVFLY
EMLVGDTPFYADSLVGTYSKIMNHKNALTFPDDSDISNDAKNLICAFLTDREVRLGRNGV
DEIKRHPFFKNDQWTWENIRETAAPVVPELSSDTDTSNFDDIEEDRGEEETFPIPKAFVG
NQLPFVGFTYYSTQHHLRGPAASKTSDKRSSSTKEDKSHLENLQKQIYQLQEQLHIEMQQ
KDELEQKCRTSNTKMEKIMKDLDEEANLRKSVEASMSLLEKDKIMLQHRVTEYQRKVDQE
GEKRRNLENEVSTLKEQLEDMKKISQNSQASNDKIAQLQKQLEEANDLLRAESDTAARLR
KSHTEMAKSMSQLETMNRELQERSRAGDGEKAQLEKELLLLQSTLESERRNYSQGSEEMR
ELQARLAGLQEDNKNLKINLSKVEGERKHAQERSNYLEKEMNGLEIDLNYKLKTLQQRLE
QEQTEHRVTRAQLTDKYESIEEAKSAAMIAVQQKMGEETGARIRAEGRVVEVEKQCSMLE
FDLKQSVQKMEQLMKQKERLEDEVKSLHIHLEQESNKRVIAQNDLKSRTQDVDRLRCSEK
QLKQEINTVLESKRSLEFQLAQLTKQYRGNEGQMRELQDQLEAEQYFSTLYKTQVKELKE
EIEERNRQLQEAQKKVQDLISDRDSLSAQLDLTVTKAESEQLARALQEEQYFELSQENKK
ATARHKQELGEREATIARLEESNKTLTKDVETLSKDNTELSEKLRLKEEEYVSQKEEIMA
SIKANYEKVLQTERTLKTQAVNKLAEIMNRKDMKLDQKKKGSTAELRKKEKENRKLQQEL
NQEKEKFNSMAIKYQREVNDMQAQLADEFTHRNELQMQLASKESDIEQLREKLNNLQQRM
ENSSITSLQTDETDSNPAGRSLSFRSRYQMTGELYNLRLNSYMIELSVRPVTQGDVYRAE
TEEIPRIFQILYANEGECRKELEEVPVPQGEKTNCLAHKGHEFIPTLYHFPSNCEACAKP
LWHVFKPPPALECRRCHVKCHRDHLDKKEDVIAPCKVNYDVTSARDMLLLAVTQEEQKKW
IGHLGKKIPKTPPSTFSRVSPRSMFTLWPVHQSVPRLLLSLNIFGYRTLNDLLQRAVAPL
RRNLVNIF
NT seq 3987 nt NT seq  +upstreamnt  +downstreamnt
ctactggatggcttggatgctctggtatacgacctcgacttccctgcccttaggaaaaac
aagagcattgacaacttcttgaatagatataaaaaaactattagtaaaataagggatttg
cgaatgaaagcagaagactatgaggtggttaaagttattggaagaggtgcatttggagag
gttcagttggtaagacacaaatccacacataaagtatatgccatgaagctgctgagcaag
tttgagatgatcaaaaggtcagattccgctttcttctgggaagagagggacataatggct
tttgccaacagtccgtgggttgtgcagctcttttttgcattccaagatgaccgctacctc
tacatggtgatggaatacatgcctggtggggatctggttaacttgatgagcaactatgac
gtcccagagaagtgggcccgcttttacacagcagaggtggtgcttgctctggatggaatc
cactccatgggtttcattcacagagatgtaaagcctgataacatgttgctcgacaaatcg
ggtcacttaaaacttgcagactttggaacgtgcatgaaaatgaatgaggatggaatggta
cagtgtgacacagcagttggaactccagactacatttcaccagaggtactgaaatcccaa
ggaggaaacgggaactatggaagagagtgtgactggtggtcagtgggggtgtttctttat
gagatgcttgttggcgatactcccttctatgcagactcattggtggggacttatagtaaa
atcatgaaccacaagaatgccctgaccttcccagatgacagtgacatttccaacgatgcc
aagaatctcatctgcgctttcttgactgacagggaagttcggctcggccggaatggagtc
gatgagattaagaggcatcctttcttcaaaaatgaccagtggacatgggaaaacatcaga
gagaccgctgcccctgtggtgcctgaactgagcagtgacactgacaccagtaactttgat
gatatcgaggaggaccgaggagaggaggagaccttccccataccgaaggcctttgtgggc
aatcagctcccttttgtcggctttacatattacagcactcagcatcatttgcgtggtcct
gctgcctcaaagacgagtgacaaacgtagcagttcaacgaaagaggacaagagtcacttg
gagaacctgcaaaaacagatctaccaactacaggagcaactccacattgaaatgcaacaa
aaagatgagctggaacagaaatgcaggacgtcaaacacaaagatggagaagattatgaag
gacttggatgaggaggcgaacctgaggaagagtgtagaagccagcatgtctctgctggaa
aaagacaagattatgctgcagcacagagtcacagagtatcaaagaaaagttgaccaggag
ggagagaagaggcgcaatttagagaatgaagtgtcaactttaaaggagcagcttgaagat
atgaagaagatcagccagaactcacaggcctcaaatgataagattgcccaactgcagaag
cagctggaggaggcaaacgacttgctgcgtgcagagtcagacacagcagcaagactgagg
aagagccacacagaaatggcaaagtcgatgagccaactggagactatgaaccgtgagctg
caggagaggagccgggcgggagacggagagaaggcacagctggagaaggagctcctgcta
cttcagagcacgctggagtcagagcgaaggaactacagtcagggatcagaggagatgagg
gaactgcaagcgagattggctggactgcaagaggacaacaaaaacttgaagatcaatctt
tctaaagtggaaggggaacgtaagcatgcccaagaaaggagcaactaccttgagaaggaa
atgaacggtttggagattgacctgaattacaagctgaagaccctccagcagcgcctggag
caggagcagacagagcacagagtgacccgggcacagctcactgacaaatacgaatctatt
gaagaagccaaatcagctgctatgattgctgttcagcagaagatgggagaggagactgga
gccaggataagggcagaaggccgggtggtggaggttgagaagcagtgctcaatgttagaa
tttgacctgaagcagtcggtgcagaaaatggagcagttgatgaagcaaaaagaaaggctg
gaagacgaggtgaaaagtctgcacatacatctggaacaggagtcaaataagcgagtcatt
gcccagaatgacttgaagagccgcactcaggatgttgaccgcctacggtgttcagagaag
cagctcaagcaggagatcaacaccgtgctggaaagcaaacgctctctggagttccaactg
gcacagctgacaaagcagtacagaggcaacgagggacagatgagggaacttcaggaccag
cttgaagccgaacagtatttttctacactttacaaaactcaggttaaggaattaaaagag
gagatagaagaacggaacaggcagttacaagaagcacagaagaaggtgcaggatttgata
agtgatagggattcattgtctgctcaactggatctgacggtaaccaaggccgagtctgag
cagctcgctcgggctcttcaggaagagcagtacttcgaactcagccaagagaacaagaaa
gcaacagctaggcacaagcaagagttgggagaaagagaggccactattgcacggcttgag
gaatcaaataaaacactgaccaaagatgtggagaccctcagcaaagataacacagagctg
agtgagaagcttcgtcttaaggaggaagaatatgtctcacagaaggaagagatcatggct
tcaatcaaagccaactatgagaaggtgctccaaacagagcgcacactgaagactcaggct
gtcaacaagctggcagagatcatgaatcgtaaagatatgaagcttgaccagaagaagaaa
ggtagcactgcagaactgcgcaagaaggagaaagagaaccgcaagcttcagcaagaactc
aatcaagagaaagagaagtttaacagcatggccatcaagtaccagagggaggtcaatgat
atgcaggcgcaacttgcagacgaattcacacatcgcaacgagctgcagatgcagttggct
agcaaggaaagtgacatcgagcagctccgcgagaagctgaacaatttgcagcaaagaatg
gagaattcaagcatcaccagcttgcagactgatgaaacggacagtaatcctgcaggtagg
agtttatcttttagaagtaggtatcaaatgactggagaattatacaatttaagactgaac
agttacatgattgaattgtctgtgagacctgtcacccaaggggacgtataccgcgcagaa
acagaagagattcctaggatatttcagattctatatgccaatgaaggagagtgcagaaag
gagcttgaggaagttcctgtccctcagggcgaaaagaccaactgtcttgcacacaaaggt
catgagttcatccccacactatatcacttcccctccaactgtgaggcctgcgccaagccc
ctgtggcatgtattcaagccgcctccggccctggagtgccgccgctgccacgtgaagtgc
cacagggaccaccttgacaaaaaggaagacgttattgctccttgcaaagtaaactatgat
gtcacctctgcccgggatatgctcttactggccgtgacccaggaggagcaaaagaaatgg
atcggccaccttgggaaaaagatcccaaagaccccaccttcaacattctccagagtctca
cctcgtagtatgtttaccctgtggccggtgcatcaatccgtaccacgtcttctcctttca
ctgaacatctttggctacaggactctgaacgacttgcttcaaagggcagtagcccccttg
aggagaaacttggtgaacatcttctga

DBGET integrated database retrieval system