KEGG   Cyprinodon variegatus (sheepshead minnow): 107083749Help
Entry
107083749         CDS       T06110                                 

Gene name
npr2
Definition
(RefSeq) atrial natriuretic peptide receptor 2
  KO
K12324  atrial natriuretic peptide receptor B [EC:4.6.1.2]
Organism
cvg  Cyprinodon variegatus (sheepshead minnow)
Pathway
cvg00230  Purine metabolism
cvg01100  Metabolic pathways
cvg04270  Vascular smooth muscle contraction
Brite
KEGG Orthology (KO) [BR:cvg00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107083749 (npr2)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107083749 (npr2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cvg01001]
    107083749 (npr2)
Enzymes [BR:cvg01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     107083749 (npr2)
Protein kinases [BR:cvg01001]
 Serine/threonine kinases: Other
  RGC family [OT]
   107083749 (npr2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc ANF_receptor Pkinase_Tyr Pkinase HNOBA
Motif
Other DBs
NCBI-GeneID: 107083749
NCBI-ProteinID: XP_015228680
Ensembl: ENSCVAG00000010289
UniProt: A0A3Q2CS49
Position
Unknown
AA seq 1049 aa AA seqDB search
MGRRGALGCCLLAALCCCCLLRGCWSNITVAVMLPDNIHKYPWALPRVFPAILMAHEDLH
SKHKLLLKHQIKILNYSTEDPAAGSCAESRAQVLAVDAKLYVRPDVFFGPGCVYPLASVA
RFASHWKLPLITAGGPAYGFDTGEEYRTIVRSGPTATKMGDFTNALHTHFNWTSRAVVIF
YDLREDDRPYYFLSEGIYLNLKQTMNVTVEARPYKVGEDYKELVTFMKEFGRIIYICGPL
ESFMSIMKLFQNEIQDPENYAIFYLDVFAESLTHRKPWLKANFKWDDAMEVFKSVFVLTY
HPPDNPEYLDFQKKLHARAQRDFGVHLEPSLMDYIAGSFYDGFLLYAIALEETLAEGGEQ
NDGLNITMRTQNRQFWGVTGLVTTDEKNSRNIDMDLWAMTNQETGEYGVVAYYNGSAKDI
IWSQTEKIHWPSGGPPLDNPPCVFSSDDPSCNDGQLPVLGIVAVGSGLALIIFGISSFLI
YRKLKLEKELAGMLWRIRWEELQFESPNKYHKRAGSRLTLSQRGSSYGSLITAHGKYQLF
AKTGYFKGNLVAIKHVNKKRIELTRQVLMELKHMRDVQFNHLTRFIGACIDAPNICIITE
YCPRGSLQDILENESINLDWMFRYSLINDIVKGMNYLHNSYFGCHGNLKSSNCVVDSRFV
LKITDYGLASFRSSCENDDSHALYAKKLWTAPELLIYDRHPPQGTQKGDVYSFGIILQEI
ALRNGPFYVEGMDLSPKEIIQKVRNGQKPYFRPTTDNKCHPEELTVLMEACWAEDPAERP
DFGYIKIYMAKLNKDGSTSILNNLLSRMEQYANNLENLVEERTQAYLEEKRKAENLLYQI
LPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTSLSAESTPLQVVTLLNDLYTCFDAII
DNFDVYKVETIGDAYMVVSGLPVRNGKLHAREVASMSLALLEQVKTFKIRHRPNDQLRLR
IGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGEALKIHVSSATKEVLDEFGYFDL
QLRGDVEMKGKGKMRTYWLLGEKTDVYVI
NT seq 3150 nt NT seq  +upstreamnt  +downstreamnt
atggggcgcagaggcgcgctgggatgctgtctgctcgccgcgctctgctgctgctgcctc
ctccgcggctgctggagtaacatcaccgtggctgtgatgctgcctgacaatatccataag
tacccgtgggctctgccgcgcgtgttcccggccatcctcatggcgcacgaggatctgcac
agcaaacacaaactgctgctcaaacaccagattaagatcctgaactacagcacggaggac
cccgccgcgggctcctgcgcagagagccgcgctcaggtgctggccgtggacgccaagctg
tacgtgcgcccggacgttttcttcggacctggttgcgtttatccgctcgcgtccgtggcg
cgcttcgcctcccactggaagctgccgctgatcaccgccgggggccccgcgtacggcttc
gacaccggggaggagtacaggactatagtgcgcagcgggcccaccgccacaaagatgggg
gacttcaccaacgcgctgcacacgcattttaactggacgtcccgcgccgtggtgatcttc
tacgacctgcgggaagatgaccggccctactacttcctgtctgaggggatctacctgaac
ctgaagcagaccatgaacgtgacggtggaggcgcggccctataaagtgggggaggactac
aaggagctggtcacctttatgaaggaattcggcagaatcatttacatctgtgggcccctg
gagtcattcatgagcatcatgaagctgttccagaacgagatccaagacccggaaaactac
gccatcttctatctggatgtgtttgcagagagcttgactcatcgcaaaccgtggctgaag
gccaacttcaaatgggacgatgcgatggaggtctttaagtctgtttttgtgttgacgtac
catcccccggataatccagagtatctggacttccagaagaaactccatgccagagctcag
agggatttcggtgttcacctggaaccatctttaatggactacatcgctggcagtttttat
gatggctttttgctgtatgcaattgccttggaagagactttggcagagggcggagaacag
aacgatggccttaacatcacgatgaggacacagaatcgtcaattctggggagttacggga
cttgttaccacagatgaaaagaattcaagaaatatagacatggacctgtgggcaatgacc
aaccaggagacaggagagtatggggttgtggcttactacaatggaagtgccaaagatatt
atttggtcccaaacagagaagatccactggcccagtggaggaccacccctggacaacccc
ccctgtgtgttttcctcagacgacccttcctgcaatgatggtcagctcccagttctgggc
atcgttgcagtgggttctggattagcgctcatcatttttggaatctccagtttcctcatt
tacaggaagctgaagctggagaaggagctggctgggatgctgtggaggattcgctgggag
gagcttcagtttgagagccccaataaataccacaaacgagccggcagcaggttaaccctc
tcacagagaggctccagctacggctccttgataactgcccatggaaaatatcagctattt
gcaaaaactggctattttaaggggaacttggtggccattaaacatgtcaacaagaagagg
atagagctgacaagacaagtattaatggaacttaaacatatgagagacgttcagttcaac
catctgaccaggttcatcggggcctgcatcgacgctcccaacatctgcatcataacagag
tactgccccagaggaagcctacaggacattttggagaatgagagcataaacctggactgg
atgttccgctactcactgatcaatgacatagtaaagggaatgaactatctccacaacagc
tactttggctgccatggaaatctgaagtcatctaattgtgtggtggacagcagatttgtt
ttgaaaatcacagattatggtttggccagctttcgctcatcctgcgaaaatgatgattcc
catgccctctatgcaaagaaactttggacagctcctgagctgcttatatatgaccgccac
ccccctcaggggactcagaagggtgatgtgtacagcttcggcatcatactgcaggaaata
gctcttagaaatggacctttctatgtggaaggcatggatctcagccctaaagagatcata
cagaaggtgaggaacggacagaagccgtactttcggccaaccacagataacaaatgccac
ccagaggagctgaccgtcctgatggaggcctgttgggccgaagacccggcagagaggccg
gattttggctacatcaagatttacatggcaaaacttaacaaagatggcagcaccagcatt
cttaataacctgctatccaggatggaacaatacgccaacaacctcgagaacctggtggag
gagaggacacaagcatacctggaggaaaaacgaaaggctgaaaacctcctctaccaaatc
ctaccacactcagtcgcagagcagctaaaacgaggagaaacagtgcaggcggaggccttc
gacagtgtcacgatttacttcagcgacattgtcggattcacgtctctgtctgcggagagc
acgcccctgcaggttgttacgttgctcaatgacctctacacatgctttgatgccataatt
gataactttgacgtctataaggtggagaccatcggtgacgcctacatggtggtgtccggg
ctccctgtgcgaaatggcaaactccatgccagagaggtcgccagcatgtcactggcgttg
ttagagcaggtgaaaaccttcaagatccgacacagaccgaatgaccagctcagactgagg
ataggtatacacacaggtccagtgtgcgccggtgtggtggggctgaaaatgcccagatac
tgtttgtttggagatactgtcaacacagcatctcgaatggaatccaatggagaggcctta
aagatccacgtatcctcagccaccaaagaagtgctggatgagtttggttactttgacctt
cagctcagaggagacgtagaaatgaagggcaaaggcaaaatgagaacatattggcttctt
ggggagaagactgatgtgtatgttatctga

DBGET integrated database retrieval system