KEGG   Cyprinodon variegatus (sheepshead minnow): 107084285Help
Entry
107084285         CDS       T06110                                 

Gene name
cacna1i
Definition
(RefSeq) voltage-dependent T-type calcium channel subunit alpha-1I
  KO
K04856  voltage-dependent calcium channel T type alpha-1I
Organism
cvg  Cyprinodon variegatus (sheepshead minnow)
Pathway
cvg04010  MAPK signaling pathway
cvg04020  Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:cvg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107084285 (cacna1i)
   04020 Calcium signaling pathway
    107084285 (cacna1i)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:cvg04040]
    107084285 (cacna1i)
Ion channels [BR:cvg04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   107084285 (cacna1i)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans PKD_channel TMEM208_SND2
Motif
Other DBs
NCBI-GeneID: 107084285
NCBI-ProteinID: XP_015229554
Position
Unknown
AA seq 2319 aa AA seqDB search
MSEEEEGPGVATSTTQSAATTSKVTTTIAKSRDAVVSSSSPCWSSPCYHLYPEEKKAEKE
EKGIIKEERIKEEEKELKEVEEREGDDEEEDDDDSSSDTSVLVVPHPELVPVVFFCLKQT
TCPRSLCIRMVCSPWFERVSMMVILLNCVTLGMYQPCENIDCSSDRCQILQAFDAFIYIF
FAMEMVIKMVALGIFGRRCYLGDTWNRLDFFIVMAGMVEYSLDLQNINFTAIRTVRVLRP
LKAINRVPSMRILVNLLLDTLPMLGNVLLLCFFVFFIFGIIGVQLWAGLLRNRCYPEENF
TLTTGISLPRPYYMADEDDERPFICSLPVDNGIMSCLDVPARREGGRACCLDKEDVFYRQ
SIGLSPEPLSNGSISVAGLCVNWNQYYTRCHTGSSNPHKGAINFDNIAYAWIVIFQVITL
EGWVEIMYYVMDAHSFYNFIYFILLIIVGSFFMINLCLVVIATQFSETKQREHQLMQEQR
ARCSSSSTLASEPGDCYEELFQLVCHCLRKGRRQTIAFFNNLRGKPRGFQGVGRGRRGGV
EREGKVKRREERERRLVSRPAHPCPHHHKADNTSAAEPVALTATSNVDGCPRCAAALKLK
DGVGSLCVAGNETEEGTREKSDEDKQKQGNQNKDRKKQSSGENHIGCSPKKQCKELWQQT
RKKLWGIVESKYFNRGIMIAILINTISMGIEHHEQPDELTNVLEICNIVFTSMFSLEMIL
KLTAFGSFNYLRNPYNVFDGIIVIISVCEIVGQSDGGLSVLRTFRLLRVLKLVRFMPALR
RQLVVLMKTMDNVATFCMLLMLFIFIFSILGMHIFGCKFSLKTETGDTVPDRKNFDSLLW
AIVTVFQILTQEDWNAVLYNGMAATSPLAALYFVALMTFGNYVLFNLLVAILVEGFQAEG
DANRSYSDDDHSSSNYDESEKRDSIKLSDPRICTLTPNGHLELGALYGSRGSYSSEKQSF
TNESRKSSLMSLGKSSMERRSLSLRHGRSSNYHNWGRPFPPQSVWSRRSSSNSLGRRSYG
SGGVPPVGGSLRVRSTRSPYSYNHASEQESLLSHPVHSHHPLPPSLFLSKHFGARGDRRA
LSLELPELLRTGGQAPGLPPTQIKDHGRKNGSGAVGSLMGGSGVGSGLGLEHRDCNGKAS
GHHNHLITDVFPQVNARKDRTDLDEETDYSWCFRIQKMMEVYKPDWCETRENWSVYLFSP
QNKFRLLCQSIIAHKLFDYIVLVFIFLNCITVALERPRILQGSLERLLLTLSNYIFTAIF
VAEMTVKVVSMGLYLGETAYLRSSWNILDGFLVFVSLIDIVVSMAGGAKILGVLRVLRLL
RTLRPLRVISRAPGLKLVVETLITSLKPIGNIVLICCAFFIIFGILGVQLFKGKFYYCVG
FDVKNITNKSDCLAANYRWVHHKYNFDNLGQALMSLFVLASKDGWVNIMYHGLDAVGIDQ
QPVTNNNPWMLLYFISFLLIVSFFVLNMFVGVVVENFHKCRQHQEVEEARRREEKRQRRM
EKKRRKAQKLPYYSSYGRTRLAIHALCTSHYLDLVITFIICINVITMSLEHYSQPQSLET
ALKYCNYFFTSTFVIEASLKLVAFGFRRFFKDRWNQLDLAIVLLSVMGITLEEIEINASL
PINPTIIRIMRVLRIARVLKLLKMATGMRALLDTVVQALPQVGNLGLLFMLLFFIYAALG
VELFGELVCNADYPCEGMSRHATFENFGMAFLTLFQVSTGDNWNGIMKDTLRECPPEHPG
TDYGCHAGLQFISPLYFVSFVLTAQFVLINVVVAVLMKHLDDSNKEAQEDAEMDAEIELE
LAQGGLCCMMGGIGAIAGATGGAAAGTGISGASTGTVTGGPVGCTSSAVIAPLRDGGGGC
SINDGHIHPRCRLYSPSQESQWLDSVSLLIKDSLEGDMIDNLSGSVFHHYCSSPVCKDCK
SHPQEIRLAEVEAASLMSEQLSDKSSSPVLPDDLSLDEHSSYQLLVTESQRDCSDSNSSE
ELLTQEVCRRPHLSSSGSNGGVQECKDSIHPLLIPPLPERRTSAHEKEGDEKRCSGSGDV
TSAILHLPADFFHPAAAAHSDSHGDRTIPKDTGPAMLATPASWASLRSPGANNKPLSSQN
PSQSDSSLATGSSDGSLQATLDERLGLGICPPQHLSLPVPLLCPVPSLVLHPRETQKANQ
GSPLLNRRSSALTLHATRRKQRSQSSSGGGSTSPGFTQQDSMDPSDEEAGTGRDGCHQAL
YNEHLSETLNSLSLTSLLTPCTMAPTMIKKCNSTGSLDQSNLSARGKDGRHLCAIDAHGF
LSNPWTEGRGKGPGEDSYMTGFSRKTSTRQNNTSFRKKR
NT seq 6960 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaggaggaggagggccctggtgttgcaacatcaacgacacagtcagcagcaaca
acctccaaggtaacaacaacaatagccaaaagcagggatgctgttgtttcatcctcgtcc
ccctgctggtcctctccttgttaccacctgtatcctgaggaaaaaaaggcagaaaaggag
gagaaagggatcattaaggaagagaggatcaaggaagaagaaaaggagctgaaggaagtg
gaggagcgtgaaggtgatgatgaagaggaggatgatgatgacagcagcagcgataccagt
gtgttagttgtgccccatcctgagctggtgcctgtggtcttcttctgtctgaaacagaca
acctgcccccgcagcttgtgcatccgtatggtctgcagtccatggttcgagcgtgtcagc
atgatggtaatcctgctcaactgcgtgacccttgggatgtaccagccctgcgaaaacatc
gactgctcctcagaccggtgccaaatattacaggcctttgatgcgttcatctacatcttc
tttgctatggagatggttataaagatggttgctctgggaatatttgggcggcgctgttac
cttggggacacatggaaccgtctggatttcttcatcgtcatggcagggatggttgaatac
tctctggatttgcagaacatcaactttacagccatcagaactgtgagggtgctgcggcct
ctcaaggcgattaacagggtgccaagtatgcgtatcctggtgaacctgctgctcgacact
ctgcccatgcttggcaatgtgctcctcctctgcttttttgttttcttcatatttggcatc
attggagtacagctgtgggcggggctgctcaggaaccgttgctaccctgaagagaatttc
acactcaccacgggtatcagtctccctagaccttactacatggctgatgaagatgatgag
cggcctttcatttgctccttgcctgttgacaacggcatcatgtcctgcttggatgtccca
gcccgtcgtgaaggaggcagagcctgttgtttggataaagaggacgttttctaccgccag
tccattggattgagtcctgaacctctgagcaatgggagtatcagtgtagctggcctgtgt
gtcaactggaaccagtattacacccgatgtcatactgggagcagtaacccacacaaaggt
gctatcaattttgataacattgcctatgcctggattgtcatatttcaggtgattactctg
gagggatgggtggaaattatgtactatgttatggatgcgcactctttctacaactttatc
tacttcatcctgttgataatagttggatcctttttcatgatcaacctgtgccttgtcgtc
attgcaacccagttttcagagacgaagcagcgggagcatcagttaatgcaggagcagcga
gctcggtgctcatcctcttcgacgctggccagtgagccaggagattgttatgaagagctc
ttccagttggtttgccactgcctccgcaagggccggagacagaccattgcattttttaac
aacttaagaggtaaacctcgtggattccaaggtgttgggagaggaagacgtggaggggta
gagagagaagggaaggttaaaagaagagaagaacgtgagagaagactagtgtcaaggcct
gctcatccatgccctcatcatcataaagcagacaacacttcggcagctgagcctgtagcc
ctgactgctacctcgaatgttgatggttgtccccggtgtgctgcagctctaaaactaaaa
gatggagttggatctctatgtgtagctggaaatgaaacagaagagggaaccagggagaaa
agtgatgaagataagcaaaaacaaggaaaccaaaacaaggacagaaaaaaacagagtagt
ggggagaaccatataggttgtagtccaaagaaacagtgtaaagaactttggcagcagaca
aggaagaagttatggggcattgtagagagcaagtactttaaccgtggcatcatgatcgcc
atcctaatcaacaccatcagcatggggattgagcaccacgagcagccagatgagctcacc
aatgtactagaaatctgcaacattgttttcaccagcatgttttccctggagatgatccta
aagttaactgcttttggctctttcaattacttgcgaaacccctacaatgtcttcgatgga
atcatcgtcattataagtgtttgtgagattgttggccagtcggatggtggtttatctgtg
ctaaggacattccggctgttgagggtgctgaagctggtgaggttcatgccggctctcagg
agacagcttgtcgttctaatgaagactatggacaatgtggccaccttttgtatgttacta
atgctcttcatcttcatattcagtattctcgggatgcacatctttggctgtaaattcagt
ctaaagacagagactggggatacagtaccagacaggaagaactttgactctttgctgtgg
gctattgtcactgttttccagattctgactcaggaggattggaatgcggttttgtacaac
ggcatggcagctacctcaccacttgctgctctttactttgtggcgctcatgacatttgga
aactatgtcctgtttaatctactagtggccattttggttgaagggtttcaggcagagggt
gatgcgaatcgctcctactctgatgatgaccactcttcttcaaactatgatgagagtgag
aaacgtgactcaataaagctgtctgatccgaggatttgtactctaacaccaaacggtcac
ctggagcttggtgccctctatggctccaggggatcctattcttcagagaagcagagcttc
accaatgaatccagaaagagcagcctaatgagtctggggaagagcagcatggagagacgc
tccctttctctgcgtcatggtcgcagttccaactaccacaactggggccgtccttttcct
ccacagtctgtatggagtcgcaggtctagctcaaacagccttgggaggaggagctatggc
tctggtggagtacctccagttggaggcagcctgcgcgtccgcagtacccgctccccctat
tcctacaaccatgcttcagagcaagagtcccttctctcgcaccctgtgcactcccatcat
cctctcccaccctctttgttcctctccaaacattttggtgcaagaggggatcgaagggct
ctttcactggaactcccagagttgctccgcacaggtggacaagctccaggactgccacca
acacagattaaagatcatggaagaaagaatggttctggggcagtaggcagtctcatggga
ggctcgggagttggtagtggtttaggccttgaacacagggactgtaatggaaaagcatca
ggtcatcacaatcatctgataactgatgtcttcccccaagtcaatgcacgcaaggacagg
acagatctagatgaagaaacagactatagttggtgctttcgtattcagaagatgatggag
gtatacaagccagactggtgtgaaactagagagaactggtctgtctatcttttctctcca
caaaataagttcaggcttctctgtcaatccataattgctcataagctttttgactacata
gtcctggtctttatcttcctcaactgcatcacagtggctctggagaggcctaggattctt
caaggaagcctggaaaggctgttacttacactttcaaactacatattcacggccatcttt
gttgcagaaatgacagtcaaggttgtgtccatgggtctatatctcggggaaacagcatat
ctgaggagcagctggaacatcctggatggttttctggtgtttgtgtctctcattgatatt
gtagtgtcaatggcaggaggtgctaagattctgggggttctccgtgtactccggctgctg
cggacactccgacctcttagggttatcagcagggctccaggactgaagctggtggtagag
acactaattacttctctgaaacccattggcaacattgttcttatttgctgtgcctttttc
atcatctttgggattcttggagttcagctcttcaaaggcaagttctactactgtgtgggt
tttgatgtgaagaacatcactaataaatcggactgccttgctgccaactaccgatgggtt
catcataaatacaactttgacaaccttggacaggctcttatgtcattatttgtgctggca
tcaaaagacggctgggttaacattatgtaccatggattagatgcagtgggaatcgaccag
cagccggtgaccaacaacaatccgtggatgctgctgtacttcatatctttcctcttgatt
gtcagctttttcgtcctcaatatgtttgtgggtgtggtggtggagaatttccacaagtgt
cggcagcatcaggaagtggaggaggcaaggcgtagagaagaaaagcgccaacgtcgcatg
gaaaagaagaggagaaaggcacagaaactgccatactattcttcttatggccgtacccgc
ctggccatccatgctctgtgtaccagccactacctggacttagtaatcaccttcattata
tgcattaatgtcatcactatgtccctggagcactacagccagccacagtcacttgagact
gccctcaagtattgcaactacttcttcacctctacctttgtgattgaggcgtctctcaag
ctagtggcatttggcttccggcgcttcttcaaggacaggtggaatcagctggacttggca
atagtcctcttgtctgtaatgggcatcactctggaggagattgaaatcaacgcctctctt
ccgatcaatccgaccatcatcaggatcatgagggtgctcagaatagcacgagtgctgaaa
ttactgaaaatggcaacaggcatgagggccctacttgacacagtggtccaggctctacct
caggtgggaaacctaggactgctattcatgttgctgttttttatatatgctgctcttgga
gtagagctatttggagagcttgtttgcaatgctgactacccttgtgagggaatgagccgc
catgctacatttgaaaactttggaatggcctttcttactctcttccaagtatcaacaggt
gacaactggaatggcatcatgaaggatactctgagggaatgcccaccagaacatcctggc
acagactatggctgccatgctggactgcagttcatctctccattgtactttgtgtcattc
gtgctcacagctcagtttgtcctgataaatgtggttgttgctgtgcttatgaaacacctg
gatgactctaacaaggaagcgcaagaagatgcagagatggatgcagaaattgaattagag
ctggctcaagggggcctctgctgcatgatgggtggaatcggagccattgccggagctaca
ggtggggctgcagctgggacaggcataagcggagcttcaactgggactgttacaggagga
ccagtcggttgtacaagtagtgcagtaattgctccactgcgagatggaggaggaggttgc
tcaattaatgatggccacattcatcctcgatgtcggctctactctccttcacaagagagc
cagtggctggacagtgtgtccctgctgattaaggactcattggaaggagacatgattgac
aacctctctgggtcagttttccaccactactgctcttcccctgtctgcaaggactgcaaa
agtcacccacaggagatccgattggcagaggtggaagcggcatcactgatgtcagaacag
ctgtcagacaaatcctcatctccagtgttacctgatgaccttagcctggatgaacacagc
agctaccagctgcttgtcacagagagtcagagggattgcagtgactccaacagttcggag
gagttgctcacacaggaggtctgcagaagacctcacctctccagttcagggagtaatggt
ggcgttcaggagtgcaaggattctattcatccacttctaattcctcctttgccagagcgg
cgaacctcagcacatgaaaaagaaggtgatgaaaaaagatgcagtggatccggtgatgtc
acttcagccatacttcacctaccagcagattttttccatccagctgccgcagcacattca
gatagtcatggggacagaacaattcctaaagacacaggcccagccatgcttgccacccca
gcctcctgggcctccctgcgctctcctggagctaataacaagcctttgagctctcagaat
ccatcccagagtgactcgtccttggccacgggcagttcagatggcagcctgcaggcaacg
ctggatgaaaggctcggccttggcatctgcccacctcaacacctaagtctccctgtgcct
ctcctctgccctgtccccagccttgtgttacaccctcgagaaacacaaaaagcaaaccag
gggtcgccattgctaaatagacggagctctgctcttactttgcatgcgactcgcaggaaa
cagaggagtcagagcagcagcggcggtggaagcaccagcccgggattcacccaacaggac
tccatggacccttcagatgaagaggcagggacaggaagggatggctgccaccaagccctc
tacaacgaacatttgtcagaaacactgaacagtctctctctgacatcgctgctaacacca
tgcacaatggctcccacaatgataaagaaatgtaacagcacgggctctctagatcagtca
aatctatctgcccgaggtaaagatggccgacacttatgtgccatagatgctcatggtttc
ttgtccaacccctggactgagggaaggggaaaaggtccaggcgaggacagttatatgaca
ggttttagcaggaaaaccagcactcgacaaaacaacacaagctttaggaaaaaaagatga

DBGET integrated database retrieval system