KEGG   Cyprinodon variegatus (sheepshead minnow): 107084898
Entry
107084898         CDS       T06110                                 

Gene name
ahrr
Definition
(RefSeq) aryl hydrocarbon receptor repressor
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
cvg  Cyprinodon variegatus (sheepshead minnow)
Brite
KEGG Orthology (KO) [BR:cvg00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cvg03000]
    107084898 (ahrr)
Transcription factors [BR:cvg03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    107084898 (ahrr)
SSDB
Motif
Pfam: PAS HLH PAS_3 PAS_9
Other DBs
NCBI-GeneID: 107084898
NCBI-ProteinID: XP_015230444
Ensembl: ENSCVAG00000005003
UniProt: A0A3Q2DS19
Position
Unknown
AA seq 680 aa
MIPPGDCMYAGRKRRKPVQKQKPSSASEKSNPSKRHRDRLNAELDRLASLLPFPPDVISK
LDKLSVLRLAVSYLRVKSFFQVSQDKPSRKHITSTASSNPEPRKDSLPLGTSINESSLLL
ESLTGFALVVSSDGMVFYASSTIVDYLGFHQTDVMHQNVFDYIHIDDRQEFRRQLHWAMC
PPQGTSGQQDNQLASGSSEDFVVSSMFNSPEAGEISPELSCFLNRCFMARVRCLLDSTSG
FLTMQFQGRLKFLHGQKKKSPSGTLMPAQLGLFCIAVPLLLPSITEMKVKNILMRGKNKS
GGIISPTEHGEHGDHLRRHSISGGVGDMTDPLLFSCPHPGSTQRSHHGSWNPLCKDNLKF
SPDGFYNQEEPLNFCKSSMTVHKGVGSGLGGGWHRRQHLGAVRAAQGVGYIPSNRLNRTG
QYGKPYCLSPSCHSGRGADVFVSKLYGSSDPDAYCVDLVKSENDFGECYEGHMMPEMPPI
KIEHDSDSENGCDAYGQTWGCRNQMAMDRRYGNGVYDSNAGLQLKSETDYYDPQYSPCQR
GKAGISPSYNNGNYPNYAVNNGTRLLKCDKDLVGNSDSNQFSPQRLSHSDSLCSNQSVNL
MNSNLYPQKAYMHMDYNKHGDYEFKGHGLIHSIKREPVDSPPWSENGHEMNQSMMGGSRN
VMPCVMSTGHHKSSPYIYMQ
NT seq 2043 nt   +upstreamnt  +downstreamnt
atgatcccaccaggagactgcatgtatgcgggcaggaagaggaggaagcccgtccagaaa
cagaagccgtcgtctgccagtgagaaaagcaacccgtccaagcggcacagggacaggctc
aatgccgagctggaccggctggccagcctgctgccgttccccccagatgtcatctccaaa
ctggacaagctgtccgtgctgcgcctggccgtctcctacctccgcgtcaaaagcttcttc
caagtgagtcaagacaagccctccaggaaacacatcaccagcacagcatcctctaaccct
gaacccaggaaagatagccttcctctgggcaccagcatcaatgagagcagcctcctgctg
gaatctttaacaggctttgctttggtggtgagcagtgatgggatggttttttatgcttcc
tccaccatcgtggactatcttggattccatcagactgatgtgatgcaccaaaacgtcttt
gactacatccacatagacgaccgtcaggagttcagacgccagctccactgggccatgtgc
cccccacagggcacctctgggcagcaggataaccaattagcttcaggatcaagtgaagac
tttgttgtgagcagcatgtttaactctccagaggcaggggaaatttctcccgagctctcc
tgctttcttaacagatgtttcatggccagagttcggtgtctcttggacagcacctctgga
tttttgaccatgcagtttcagggtcggttaaagttcctccatgggcagaagaagaaatca
ccctccgggacactgatgcctgctcagctgggtcttttctgcatagccgtccccctcctg
ctgccctccatcacggagatgaaagtgaaaaatattttaatgcggggaaagaacaaaagc
ggggggattatctctccaactgagcatggtgagcatggggatcacctaaggaggcactcc
atcagtggaggagtgggtgacatgaccgaccctctcctcttttcttgtccccacccgggt
tctacacaacgaagtcatcatggctcctggaaccctctttgcaaagacaaccttaagttc
agccctgatggcttctacaaccaagaggagcctctcaatttctgcaagtcctctatgact
gtccataaaggtgtcgggtcgggcttaggtggaggctggcacaggcgacagcacttgggg
gccgtcagagctgctcagggagtgggctacatcccctcgaaccgtttaaacaggactggc
cagtacggtaagccctactgcctttctccgagttgccacagtggcaggggtgcagatgtg
tttgtctcgaagctgtacggatcatcggaccccgatgcttactgcgtagacctggtgaag
agcgagaacgacttcggggaatgctatgaaggccacatgatgccagaaatgccacctatt
aaaatagagcatgactcagactctgagaatggatgcgacgcatacgggcaaacgtggggc
tgtcgcaaccaaatggccatggaccgccgctacggaaacggggtgtacgactccaacgct
ggtttgcagcttaaatcagaaactgattactacgacccacagtactccccttgtcagcga
ggaaaagcaggaatcagcccctcatacaataatggcaactaccccaactatgcagtcaac
aatggcacccgtctgttaaaatgtgacaaagacttggtcgggaacagtgattccaaccag
ttcagcccccagagactctcccactcagactctctatgcagcaaccaatcggtcaacctc
atgaattcaaacctctaccctcaaaaggcctacatgcacatggactataacaagcatggc
gattatgagttcaaaggtcacggcctgatccattcaatcaaacgggagccagtggactcc
cccccttggtctgagaacggccatgaaatgaaccagtccatgatgggcggctccaggaac
gttatgccatgtgtgatgagcacaggccaccataagtccagtccctacatctacatgcag
tga

DBGET integrated database retrieval system