KEGG   Cyprinodon variegatus (sheepshead minnow): 107085230
Entry
107085230         CDS       T06110                                 

Gene name
ankrd53
Definition
(RefSeq) ankyrin repeat domain-containing protein 53
  KO
K21441  ankyrin repeat domain-containing protein 53
Organism
cvg  Cyprinodon variegatus (sheepshead minnow)
Brite
KEGG Orthology (KO) [BR:cvg00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cvg03036]
    107085230 (ankrd53)
Chromosome and associated proteins [BR:cvg03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    107085230 (ankrd53)
SSDB
Motif
Pfam: Ank_5 Ank_2 Ank_4 Ank Ank_3 Thioredoxin_6
Other DBs
NCBI-GeneID: 107085230
NCBI-ProteinID: XP_015230934
Position
Unknown
AA seq 385 aa
MPLDQRSSTGGPWRKVSPKAPSGGPALPDVAESSEIPEVQEQQGFHAKCFYSDLPAIQAL
LESREWLINSSDSHGRRPLHMVLSSRGASNTCLRYLLEHGADVNATTVLGQTPLHFAASE
GLLESTEILVKAGADLLAKDKMGLTPLDMAHIWCHRKVARYLKHSMWHCEKMKEMEEIKL
THVLYRDLINKVEQDHLVKKTRNHDKMEEWAKKKGFPPLKELPPKTPVSKYHDRCVLPEQ
TSCKPKPTKSQSQGLQKNKVISKTTQPTVSTNIPRTVFISPQHEKPSVEPDLRESVTVWE
DSSSHRLQYITKWDTEPQPTPKAPRDVVERVLFPKAFPSRMATPLGFKPQNIEEVQHRGH
PQGRNTSPWTEVAMHLAEVLEPGHY
NT seq 1158 nt   +upstreamnt  +downstreamnt
atgcctttagatcagaggtcttcaacagggggtccgtggagaaaagtttcccctaaagct
ccatctggtgggccagcattgccagatgtggctgagagttcagagattccagaggtgcag
gagcagcagggcttccatgcgaagtgcttttacagtgatctgcctgctatccaggccctc
ctagagtccagggagtggctgatcaatagcagtgattctcacggtcgtcgccccctgcac
atggtcctgtcctcacgtggcgcctcaaacacctgcctcagatacctactggagcatgga
gctgatgtaaacgccactacagttttagggcagacccctctgcactttgctgcctcagag
ggcctgcttgagagcacagaaatccttgtgaaagccggagcagatcttttggcgaaggac
aaaatggggctcacccctctggacatggcccacatctggtgccacaggaaagtagcaagg
tacttaaagcacagcatgtggcattgtgagaagatgaaagaaatggaggagataaagctg
actcatgttttatacagagatctcatcaataaggtcgagcaggatcatctggtcaaaaag
actcgtaaccatgacaagatggaagagtgggcgaagaagaaaggctttcctcctttaaag
gagctccccccgaaaaccccggtgtccaaataccacgatcggtgtgttttaccagagcag
accagctgtaaacccaaacctactaagagccagtcacaaggccttcagaaaaacaaggtt
atctccaaaacaacgcaacccacagtctcaacaaacatcccccggaccgtcttcatcagc
ccccagcatgagaaaccctctgtagagccagatctcagggaaagtgtaaccgtgtgggag
gacagcagcagccacaggcttcagtatatcaccaagtgggacacagagccacagccgacc
cccaaagcgccgagagatgttgtcgaaagagtgttgtttcccaaagccttcccttctagg
atggccacgcctctgggctttaagccacagaacatcgaggaagtccagcaccgaggacat
ccccaggggaggaacacctctccctggactgaggtggctatgcacctggctgaggtcctg
gagccggggcactattga

DBGET integrated database retrieval system