KEGG   Cyprinodon variegatus (sheepshead minnow): 107085321
Entry
107085321         CDS       T06110                                 

Definition
(RefSeq) endoplasmic reticulum aminopeptidase 1-like isoform X1
  KO
K09604  adipocyte-derived leucine aminopeptidase [EC:3.4.11.-]
Organism
cvg  Cyprinodon variegatus (sheepshead minnow)
Brite
KEGG Orthology (KO) [BR:cvg00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:cvg01002]
    107085321
Enzymes [BR:cvg01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     107085321
Peptidases and inhibitors [BR:cvg01002]
 Metallo peptidases
  Family M1
   107085321
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N ING
Other DBs
NCBI-GeneID: 107085321
NCBI-ProteinID: XP_015231071
Ensembl: ENSCVAG00000012144
Position
Unknown
AA seq 986 aa
MKLTVMLSLVPTGHLIRQFLLPLALSPSLLTNCSRRRSGERISCFPATMFVVLLLLFVLN
HHTSGAQIPNQGQAKDPPVATNGQPFPWDRMRLPTTISPLHYDLTIHPNLTTLDFTGVVR
ISLDVREDTSVIILHAKQMLISNVMLLAPEGIRPLRVLEYPRFHQLALLSDSVLTKGRNY
EVQLEFAANLSDSFHGFYKGSYRTSSGEVRVIASTQFEATFARGAFPCFDEPAFKANFTI
RILREPRHIAISNMPKVKTVELPGGLLEDHFDTTVKMSTYLVAYIVSDFLSVSKTTKHGV
KISVYAVPEKIDQTAFALDAAVKLLDFYDDYFDIPYPLPKQDLAAIPDFQSGAMENWGLT
TYRETGLLFDPERSSASDKLGITKVIAHELAHQWFGNLVTMEWWNDLWLNEGFAKFMEFI
SLDITYPELHVDDFFLGKCFEAMEVDSLSSSHPVSTPVENPTQIQEMFDDVSYDKGACIL
NMLRDFLSPEAFEIGIIRYLKRYSYQNTVNSHLWESLTDICSSDALDEGRLKHTEFCSKV
KLQSGSSKWYSDDELDVKAIMDTWTLQEGFPLVTVEVKGREVRLSQERFLRTDNPSLTQG
FLWQIPLTYMTSASSTVHRFLLKTKADVLYLPEEVDWVKFNVNMSGYYMVHYAGEGWNNI
INLLLYNHTAISGNDRASLIQNVFQLVSVGKVRLDTALELSLYLSKETEIMAVTQGFGEL
VPLYKLMEKRDMTVLENQMKDYIVDLFRDLIDRQEWNDSGSVSERVLRSYLLLFACVRKY
PPCVAKATQMFNSWKDSDGTMSLPVDITMAVFVIGARTPEGWDFLFEKYRTSLQMSVKSR
IKTAMTVTHMQDKLKWMMEQSLRGEVMKTQDLPDVVASVGRNPHGYKLAWDFLRANWHTL
IKKFDLGSNTVSYMVAGVTNQYSTREMLQEIRNFFDSLTEEEGSKMRCIQQTYETIEDNI
RWMDTNLPLLQAWLNKRQLRAPHEDL
NT seq 2961 nt   +upstreamnt  +downstreamnt
atgaaattaacagtcatgctttctttggtacctactggacatttaatacgacagttcctc
ctgcctctggctctttcaccttcacttctaacaaactgcagcagacgtcgaagcggtgag
aggatttcctgtttcccagccactatgtttgttgtcctgctgctgctctttgttctcaat
catcacacatctggagctcagatccccaatcaaggccaagccaaagacccccctgtggcc
accaatggtcagcccttcccttgggaccgtatgagacttcccacaaccatcagccccctg
cactatgacctgaccatccacccaaacctcaccaccctggacttcactggggtggttcgt
atcagtctggatgtgcgagaagacaccagcgttattattctccatgcaaagcaaatgctc
atctccaacgtaatgctcctggcccctgagggcatcaggcccctccgggtgttggagtac
cctcgtttccatcagctcgctctgctgtcagactcagttttgaccaagggcagaaactat
gaggtccagctggagtttgctgctaatttatcagacagctttcatgggttctacaaaggc
agctaccgcaccagcagtggggaggtccgggtcatagcatctacccagttcgaggcaacc
tttgcccgcggagcctttccttgttttgacgagccagccttcaaagccaactttaccata
cggatcttacgagagccacgacacatagccatttccaacatgcccaaggttaaaacagtt
gagctgccaggcggtttgcttgaggatcactttgacacaaccgtcaaaatgagcacctac
ctggtggcctacatcgtctctgacttcctgtctgtgagcaaaacaactaaacacggagta
aagatctctgtctatgctgtcccagagaagattgatcagacggcctttgctttggatgct
gccgtgaagttgttggacttctatgatgattacttcgatatcccatacccacttcccaag
caggacttggctgccatccctgatttccagtcaggtgcaatggagaactggggtctgacc
acctacagggagactggcctcctcttcgatcctgaaagatcctccgcctcagacaaactg
ggcatcactaaggtcatcgcccatgagctcgcacatcagtggtttgggaacctggtgacg
atggagtggtggaatgacctgtggctcaacgaggggtttgccaagttcatggagttcatt
tcgcttgacatcacctacccagagttacacgtggatgacttcttcttgggcaagtgtttc
gaggcaatggaggtagattctctgagctcctctcacccagtatccaccccagtggaaaac
cccacgcagatccaggagatgttcgatgatgtttcctatgacaagggggcgtgcattctc
aacatgctgcgggattttctgagtcctgaagcctttgagatcgggatcatccgatacctg
aagcgctacagctaccagaacacggtgaacagccacctctgggagagcctgactgatatc
tgcagctcggatgctttggatgaaggtcgactgaaacacacagagttctgctctaaagtc
aaactccagtctggatcctcgaagtggtactctgatgacgagctggatgtcaaggctatc
atggacacctggacgctgcaggagggcttcccgctggtcactgtagaggtcaaaggtcgg
gaggtcaggctcagtcaggagcgtttcctgaggacagacaatccttcgctcactcaagga
ttcctgtggcagatcccacttacgtacatgaccagtgcctccagcacagttcaccgtttc
cttctcaagactaaggctgatgtcctctacctgcccgaagaagtggattgggtaaagttt
aatgtcaacatgagtggttattacatggtccattatgctggagagggttggaacaacatc
atcaatttgctgctatacaaccacaccgccatctctggcaatgatagagccagcctcatc
cagaacgtcttccagctggtcagtgttggaaaggtgaggctggatacagccctggagctt
tctctttatctctccaaagagactgagatcatggctgtgacccagggcttcggagagctc
gtcccactttacaagctgatggagaagagagacatgacagtactggagaaccagatgaaa
gattatattgtggatctattccgggatctgatcgatcggcaagagtggaatgactccggt
tcggtgtctgagcgagtgcttaggagttacctgctgctgttcgcctgtgtcaggaaatat
cctccctgcgtcgccaaagccacccagatgtttaacagctggaaggattcagatgggacc
atgagcctccctgttgacatcactatggctgtgtttgtgattggagcacggacaccagaa
ggatgggactttctctttgaaaagtaccgcacctcgctgcagatgtccgtcaagagccgt
ataaagactgctatgactgtcacacacatgcaggacaagctcaagtggatgatggaacag
agtctgcggggtgaggtgatgaagacccaggaccttccagatgtggttgcctctgttgga
aggaaccctcatggttacaaactagcctgggacttcctcagagctaactggcacaccctg
atcaagaagtttgacctcggctctaacactgtctcgtacatggtggccggtgtgaccaac
cagtactccaccagggagatgcttcaggagataaggaacttttttgactccctgacggag
gaggagggatcaaaaatgaggtgcatccagcagacctacgagaccatcgaggataacatc
cgctggatggacaccaaccttcctctgttacaggcttggttgaacaagcggcaactcagg
gctcctcatgaagatttatag

DBGET integrated database retrieval system