KEGG   Cyprinodon variegatus (sheepshead minnow): 107086952Help
Entry
107086952         CDS       T06110                                 

Gene name
si
Definition
(RefSeq) sucrase-isomaltase, intestinal
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
cvg  Cyprinodon variegatus (sheepshead minnow)
Pathway
cvg00052  Galactose metabolism
cvg00500  Starch and sucrose metabolism
cvg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cvg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    107086952 (si)
   00500 Starch and sucrose metabolism
    107086952 (si)
Enzymes [BR:cvg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     107086952 (si)
    3.2.1.20  alpha-glucosidase
     107086952 (si)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 107086952
NCBI-ProteinID: XP_015233743
Position
Unknown
AA seq 1814 aa AA seqDB search
MGKVVTVILGIVAVVMTVLAITFIALFATKGNGESIDETLDGFVPQCPNIPNAERVDCYP
DAGASKSGCEQRGCCWSPLDQRSVPWCFFPTNHGYKVESVHNSDYVIHAEMTRMKSPSMF
GGDIQQLTLHAEMQTSNRLHFKIFDSNNKRFEVPHEHIATVKSNPTTPISETLKITNEPF
GLTVSRNNRVLFDTTMAPLVFADQYIQLSAKLPSQYIYGLGEHVHQRYRHDMNWRTWPIF
TRDAFPNGGTHNLYGQYPFFLCLEDDTGKSFGVFLLNSNAMEVTLQPAPAVTYRTIGGIL
DFYLVFGDTPEQVVYEFLELIGKPVIPAYWSLGFQLSRWNYTSLAEVKKTVERNRAVNIP
YDIQYTDIDYMEDKKDFTYDKEKFKELPQFADYLHEKGQRYILILDPAIATSKRVGGAAY
ESYDRGTAKNAWVFESDGKTPLIGEVWPGETVFPDYTSQSCIDWWIDEYERFSREIKHDA
LWIDMNEVANFKQGSAKGCLDNNLNYPPYTPQILDGVMYSKTLCMDAKQAWGTHYDVHSL
YGYSMVLATEQALRRVFGSNRTLMLTRSSFPGVGKYSGHWLGDNGANWNDIKWAIPGMLE
FGLFGIPYIGADICGFFDDSSEELCRRWMQVGAFYPFSRNHNAEGYKPQDPAYYGADSVL
VKSSRHYLRIRYTLLPYLYTLFYKAHTRGDTVVRPLLHEFYNDINTWEVDRQFLWGPYLL
ITPVLDPGVEDVQAYFPDARWYDYETMVQRGDRKAFVNVHLPAEKLGLHIRGGAILPTQE
PEVTTTYSRRNPMGLIIALDDNNKASGELFWDDGDSRNTVEDGKYIHYQFSFENGILKLQ
VTNNGYKDPNNLKFEKITVLGVPARPASITMTPDGGSSTTLPDSSFTHNAGTQVLSIINL
ALELGKSYTVQWTMTASPEIPELERFDCHPEEHADENKCRARGCLWKKSETAGVPWCYYA
NDYGYSSKVISSTSSGITLDLTRNTRISSRPDSPDINNLRVQIWYHKSDMLQFKIWDPTN
ERYEVPVPLTLPSTPETDEGKRLYEVKISQNPFGIQVIRKKTGTKIWDSAVPGFTFSDLF
IQVSTRLSSNFVYGFGETEHPSYKHDLNYHTWGMFSKDQPPGYKMNCYGVHPFYMGLENS
SDAHGVLLLNSNAMDVTFQPTPALTYRTLGGILDFYMVLGPTPEMVVQEYTTLIGRPVLP
AYWSLGFQLCRYGYANDAEIEDLYNDMRAAGIPYDVQYADIDYMERQLDFVLDKVNFGGL
PDLVNKMRAEGMRFIFILDPAISGNETTDYPAFRRGKEADVFIKWPAELGNDIVWGKVWP
DFPNVTVDENLDWDTAVELYRAYTAFPDFFRTSTATWWQQEISNFYKELKFDGIWIDMNE
PASFVHGTVGGKCLGNPLLENPPYMPPLESKHMGLNHKTLCMNSEQILSNGKRVKHYDVH
NLYGWSHTKPTYDALLSVTGKRGIVVTRSTYPTSGQWAGHWLGDNNASWDQLYKSIIGMM
EFSLFGIPYTGADICGFFNPSEYELCLRWMQLGAFYPYSRNHNGKGNPRQDPVAWDERFA
NISRDVLNIRYTLLPYLYELMFEAHTKGNTVVRPLLHEFVEEKATWDIHRQFLWGPALLI
TPALDKGVTKVEGYLPNARWYDYHTAKYVGVRAQKVSMDTPLDHINLHVRGGYILPCQKP
ENNTMYSRKNPLGLIVALSDSGTAKGSFFWDDGEGIDTVAKSQYLLVDFTVNERTLTSKI
IHHQLNPADQLKLGVVKVWGAGTTKVTGATITDSTGKGTPLTAQHNNVTEELIIDATSAA
IPVHLTFTLTWKTG
NT seq 5445 nt NT seq  +upstreamnt  +downstreamnt
atggggaaagtggtgacagtgatccttgggatcgtggctgtcgttatgaccgtactggcc
atcacttttattgctctttttgcaacaaagggaaatggtgaaagcatagatgaaacatta
gatggatttgttcctcagtgtcccaacattcctaatgctgaaagagtggactgttaccct
gatgctggagcctcaaagtcaggatgtgagcagcgcggctgttgctggagtcctctggat
cagcgaagtgttccctggtgtttctttccaaccaaccatggatataaagtggaatcagta
cacaactctgactatgtgattcatgctgaaatgacgagaatgaaatctccctctatgttc
ggtggcgacatacagcagctgactttgcatgcagaaatgcagacaagtaaccgacttcat
tttaagatcttcgattccaataacaagaggtttgaggtccctcatgagcacatcgctaca
gtaaagagcaaccccaccacccctatcagcgagacacttaagatcacaaacgaacctttt
ggcctgactgtcagcagaaacaacagagtactgtttgacaccaccatggctccacttgtg
tttgccgaccagtacatacagctgtctgctaagctcccatctcaatacatctatggccta
ggtgaacatgtacatcaaagatatcgacatgatatgaactggagaacctggcccattttt
accagggatgctttccccaatgggggaacacacaatctctacggacagtatcccttcttc
ctttgtctcgaagatgatacaggaaagtcatttggggtgtttctgctgaacagcaatgcc
atggaggtgactctgcagcctgccccagcagtgacctacaggacaattggaggaatcctt
gacttctacttggtgtttggagacacaccagagcaagttgtttatgagttccttgagctc
atcggcaagcctgtcattcctgcctactggtccctgggcttccagctctctcggtggaac
tacactagtcttgcagaagtgaaaaagacagtggagaggaatcgggctgtgaacattcca
tatgatatccaatacactgacatagactacatggaagataagaaagatttcacctatgac
aaagagaaatttaaggaactgcctcagtttgctgactacctccatgaaaaggggcagaga
tacatcctcatcctggaccctgcaatagccaccagcaaaagggtagggggtgctgcatat
gagtcgtatgaccgtggtacagcaaagaacgcatgggtctttgagtcagatggaaagact
cctcttattggagaggtgtggccaggtgagacagtattcccagactacaccagccaaagc
tgcatcgactggtggatagatgagtatgagcgattctccagggagatcaaacatgacgcc
ctctggattgacatgaatgaagtggccaactttaagcaaggatcagctaaaggctgtctt
gataacaaccttaactatcctccttatactccacaaattctggacggggtgatgtacagt
aagactctttgcatggatgccaagcaggcctgggggacccactatgatgtccacagtttg
tacggctactctatggtgctggcaactgaacaagccctgcggcgtgtgtttgggtcaaac
cgtaccctgatgctgacacgctcctccttcccaggtgtagggaaatattcaggacattgg
ctgggtgacaatggtgccaactggaatgatataaaatgggcaattcctggcatgctggag
tttgggctttttggaattccctatatcggagctgacatctgtggattctttgacgactca
agtgaagagttgtgtcgtcgttggatgcaggttggagctttctatccctttagtcgaaac
cacaatgctgagggatacaagccccaggatcccgcttattacggtgccgactcagtgctg
gtaaagagctccagacattacctaaggatacgctacactctcctgccttacctctacaca
ctcttttacaaagcccacaccaggggggacaccgttgtacgtcctcttctgcacgagttc
tacaatgatataaacacctgggaagtggatcgccagtttctctggggaccatacctgctc
ataacaccagtgcttgatccgggtgtggaagatgtccaggcatattttccagatgcacgt
tggtatgactatgaaacgatggtacagaggggagaccgcaaagcatttgtaaatgtgcat
ctgcctgctgaaaagcttggcttacacatcagaggaggcgcaatccttcccacgcaggaa
cctgaagtcactacaacatacagtcgacgtaatccaatgggtctgattattgctcttgat
gacaacaacaaagcatctggggagctattctgggatgatggagattcccgaaataccgtt
gaagatggcaagtacatccattaccagttctcttttgaaaatggaatactgaagttacag
gtgaccaataatggctacaaggatccaaataatctaaagtttgagaagatcactgtcttg
ggagtgccagctcgaccagcatctatcactatgacacctgatggaggttcttctacaaca
ctaccagactccagttttacccataatgcaggcacacaggtgctttccataatcaacctg
gccctggaacttggcaagagctacacagttcaatggacgatgacggcaagcccagagatt
cctgagcttgaacgttttgactgccatccagaggagcatgcagatgaaaacaaatgcagg
gctaggggctgtctgtggaaaaaaagtgaaactgctggggttccttggtgttactatgca
aatgactacggttactcttctaaagtaatcagcagcaccagttcaggtatcacgcttgat
cttactcggaacacaaggatcagtagccgtccagactcacccgacattaataacctccgc
gtccagatttggtatcataaaagcgacatgcttcagttcaagatttgggacccaacaaat
gaacgctatgaggtaccagtacctctgacactgccttcaacgcctgagacagatgagggc
aaaagactttacgaggtgaaaatcagtcagaatccatttggaattcaggtcataaggaag
aaaacaggcaccaaaatttgggactctgctgtgccgggtttcaccttctcagacttgttc
atccaagtgtcaacacgactgtcatcaaattttgtctatggctttggagaaaccgagcat
ccctcctataaacatgatctcaactatcatacctggggaatgttctccaaagatcaacct
cctggttacaagatgaattgctatggagtgcatcccttttacatgggccttgaaaactct
tctgatgctcatggcgtgctgttactgaacagtaatgcaatggatgtaactttccagcca
actcctgctttgacctaccgcacacttgggggcatcttggatttctacatggtcctggga
ccaacacctgagatggttgtccaggagtacactacactgattggaagacctgttctacct
gcctactggtccctcgggtttcagctttgtcgctatggttatgccaatgatgcagaaata
gaagatctatacaatgacatgagagcagctggtataccctatgatgtgcaatacgcagac
attgactacatggagcgtcaactagactttgtcttggacaaagtaaactttggaggattg
ccagacctggttaacaaaatgagagcagaaggcatgaggttcatcttcattctggatcca
gctatttcaggaaatgaaacaacagattaccctgcttttagacgagggaaagaggctgat
gtcttcatcaaatggcccgctgagcttggcaacgatattgtgtggggaaaggtctggcct
gattttccaaatgtcacagttgatgaaaaccttgactgggacaccgcagtagaactgtat
cgtgcatacactgcattcccagacttcttccgtactagtactgcaacatggtggcaacaa
gaaattagtaatttttataaagaactgaagtttgatggcatttggattgacatgaatgaa
cctgcaagttttgtccatggcacagttggtggaaaatgcctgggtaatcccctactagag
aaccctccatatatgccccctctggagtccaaacatatgggcttgaaccacaagactcta
tgtatgaacagtgaacaaatacttagcaatggaaagagagtcaagcattacgacgtccac
aacctctatggatggtctcacaccaaacctacctatgatgcgttgcttagtgtgactggt
aaaagaggaatagttgtgacaaggtctacctacccaaccagtgggcaatgggcaggacat
tggctgggagacaacaacgccagctgggatcagttatacaaatccatcataggcatgatg
gaattcagtctgtttggcattccttacactggtgcggacatatgtggattctttaaccca
tctgaatatgagttgtgtcttcggtggatgcagctgggtgccttctatccatattcacgt
aaccacaatggcaagggcaacccgagacaagatcctgttgcctgggatgaaagatttgcc
aatatctccagagatgtcttgaacatccgttatactctcttgccttacctgtatgagctg
atgtttgaggcacacactaaaggaaacacagttgtcagaccgctactgcacgagtttgta
gaggaaaaagctacatgggacatccacagacagttcctctggggacctgctctccttatc
acccctgctcttgacaaaggagttacaaaagtagaaggctatcttccaaatgcacgctgg
tatgactaccacacggccaaatatgttggtgttcgtgcccaaaaagtctctatggacaca
ccattagatcatattaatcttcatgtcagaggcggatacatcctaccctgtcagaaacca
gagaacaacacaatgtacagtcgaaagaatcctttgggactcattgttgccctcagtgac
agtggaactgccaaaggatcattcttctgggatgacggggaaggaatagacacagttgcc
aaatcccaatatctcctggttgactttacagttaatgagaggaccttgaccagtaagatt
atacaccatcagctaaatcctgctgatcagctgaaactgggtgtggtgaaggtttgggga
gcaggcaccaccaaggttacaggagcaaccattacagactcgacaggaaagggaactcca
ctcactgcgcagcataacaatgtgactgaggagctgattattgatgctacctcagcagct
atccctgtgcatctaactttcacactaacatggaagacgggctga

DBGET integrated database retrieval system