KEGG   Cyprinodon variegatus (sheepshead minnow): 107089523Help
Entry
107089523         CDS       T06110                                 

Definition
(RefSeq) heat-stable enterotoxin receptor-like
  KO
K12320  heat-stable enterotoxin receptor [EC:4.6.1.2]
Organism
cvg  Cyprinodon variegatus (sheepshead minnow)
Pathway
cvg00230  Purine metabolism
cvg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cvg00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107089523
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cvg01001]
    107089523
Enzymes [BR:cvg01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     107089523
Protein kinases [BR:cvg01001]
 Serine/threonine kinases: Other
  RGC family [OT]
   107089523
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase Guanylate_cyc ANF_receptor Vpu YtxC
Motif
Other DBs
NCBI-GeneID: 107089523
NCBI-ProteinID: XP_015237850
Position
Unknown
AA seq 930 aa AA seqDB search
MSPCCWWLIVCTFWAFAALCRGNGQCGAGITINVILLEDEESPWSLKYVESEIEEAVLKD
NNINVAQGVGFNITADYEGFNTTFYTKRGCSSSICEAVEKLTKLMITGKLGCAVLGPTCT
FATFPLVDAEKGFNLSTPIISAGSFGRSCDSTLNLQRVLPPARKISDFFIKFWLENNSIK
PEWKTAYVYKKANNTEDCFWYINALEADGKFSAEVSRTMLRKPDEVKEILKTQENRTSNL
IIMCGSVQDLLELKNGSKAADSSDFLFMLIDLYNDVYYTNPSSLPEMKNVLVLTMPNTRE
YVINSDFRGNKTMNDYMAAYHDSVLYIGQVMREIFAKNQSDLHGMDYVNVNYFRNTSFKG
LAGNYKLDIKGDRDTNFSILYTTTSNEYKLLFTFDTEFNKTKVVDKNPAFVWGKKLPQYK
PNSRVAISDILVGVLTVTVVVVATIALIFYRQNRKDRLLRKRWCHINSDLISLLEDSQHN
IISLKIEDERKKVKFQIRRALYDKKIVILKELKNSDGNFNKTQTMELNALLNIDYYNLTK
FYGTVRFDEGVFGVFEYGERGSLRYVLNDKISYPEDTFMDWEFKISVMYDIAKGMSYLHA
STIQVHGRLKSTNCVVDNRMVVKITDFGCNAFLSSSKDLWTAPEHLRDQGTSQKGDVYSF
AIISQEIVLRKSTFYTQSCSNRSEKLSRVMTSYFRPDLDIEVASEKELEVYMMIKNCWDE
DPEKRPDFKKVENCLGKHISKIHNQDNESYMDNMIRRLQNYSRNLEHLVEKRTALYKAER
DRADFLNFMLLPGPVVKSLKETGVVEPELYDEVTIYFSDIVGFTTLCQYSTPMEVVDMLN
DIYKGFDSIVDNHDVYKTAGDRENVQRLQQDLAQMILSCLERRKQGSIRRKGRSVEEEED
EGRESEGDSEGGHPEYLQLATVDNTLSTFL
NT seq 2793 nt NT seq  +upstreamnt  +downstreamnt
atgagcccatgctgctggtggctgatagtgtgcaccttttgggcatttgctgctctgtgt
cgaggcaacggacaatgtggggccgggatcactatcaacgtgattcttctggaggacgag
gagtctccttggagcctgaagtatgtggagagcgaaatcgaggaagcagtattgaaagat
aacaatattaatgttgcacaaggagttggattcaatatcacagccgactacgaaggattc
aacaccactttttacaccaaaagaggctgcagtagcagtatatgtgaggcagtggagaaa
cttaccaagcttatgattacaggtaaacttggctgcgctgtgctcggacctacctgcacc
tttgcaacattccccttagttgatgcagaaaaaggctttaacctgagcacacccatcatc
tcggcgggaagctttggtcgctcctgtgactctaccctcaacctgcagcgggttctgcct
ccagcgcggaagatctcagactttttcatcaaattctggctggaaaacaatagcatcaaa
cccgagtggaagacagcctatgtctacaaaaaggccaacaacactgaggactgcttttgg
tatatcaacgcactggaagccgatggcaagttctcagcagaggtttcaagaacgatgcta
cgcaaacctgacgaagtgaaagaaatactcaagacacaggagaacaggacgagcaatttg
atcatcatgtgtggctcagtgcaggacttactagagttgaaaaatggctccaaagcagca
gacagcagtgatttcctctttatgctcattgatctctacaatgatgtatactacaccaac
ccgtcatcgctacctgagatgaagaacgtgttggtgctgaccatgcccaacacccgggag
tacgtcatcaactcagactttagaggcaacaaaacaatgaatgactacatggcagcgtac
catgactcagtgctgtatataggacaagtaatgagagagatcttcgccaaaaatcagtct
gatctacacggaatggactatgtgaatgtgaattacttcagaaacacctcgtttaaggga
cttgcaggaaattacaagctggacataaaaggagacagagatacaaacttttcaatcctt
tacacaacaaccagcaatgagtacaagctcttattcaccttcgacactgagttcaacaaa
acaaaagtggtggacaagaatccagccttcgtctgggggaagaagcttccacagtacaaa
ccaaactcacgtgttgctatttctgacatccttgtgggcgtgctgactgtcacagtggtg
gttgtggccaccatagcattgattttttacagacagaacaggaaagatcggctcctcagg
aagcgttggtgccacattaactctgacctcatctctctgctagaggacagccaacacaac
atcatttcattaaagatagaggatgaaaggaagaaggtaaaattccagatccgccgtgcc
ctctatgacaaaaagattgtgatcctaaaggagctgaaaaactcagatggaaacttcaac
aaaacccagacaatggagctcaatgcgcttctgaacatcgactattacaacctgaccaag
ttttatggcacggtcaggtttgatgagggtgtgttcggcgtgtttgagtacggagagagg
gggtcgctcaggtatgtgctgaacgacaagatttcatacccagaagacaccttcatggac
tgggagttcaaaatctctgtcatgtatgacattgcaaagggcatgtcctatcttcacgcc
agcaccatccaggttcatgggcgcctcaagtccaccaactgtgtggtggacaatcgcatg
gtggtcaagatcacagactttggctgtaacgccttcctcagcagcagcaaagatctgtgg
acggctccagagcacctgagggaccagggtacttcacagaaaggagacgtctacagcttt
gccatcatctcccaggagattgttctgaggaagtccaccttctacacccagtcctgctcc
aaccgttcagagaagttgtccagggtgatgacgtcgtacttcagacctgatctggacatt
gaggtggcttcagagaaagaactggaggtgtacatgatgataaaaaactgctgggatgag
gatccggaaaaaagaccagactttaagaaagtggagaactgcttagggaaacacatcagt
aaaattcacaaccaggacaacgagagctacatggacaacatgatccgaaggctgcagaac
tactccagaaacctggagcacctggtggagaagagaacagccctgtacaaagcagagagg
gatcgggccgacttcctcaacttcatgctgcttcctgggccagtggtgaagagcctgaag
gagaccggtgtggtggagccagagctgtacgacgaggtgaccatttatttcagcgacatt
gtgggcttcaccaccctgtgccagtacagcacacccatggaggttgtggacatgctcaac
gacatctacaagggctttgacagcatcgtcgacaaccatgacgtctacaagacagctgga
gatagagagaacgtccagcgtctgcagcaggatctggcccaaatgatcctgtcctgcctg
gagcgccgaaaacaaggatccatacggaggaagggccgttcagtcgaggaggaggaggat
gaaggccgggaatcagagggggattctgaagggggccatcctgaatatcttcagctggcc
actgtggataacaccctcagcaccttcctgtag

DBGET integrated database retrieval system